KEGG   Saccharomyces cerevisiae (budding yeast): YDL008W
Entry
YDL008W           CDS       T00005                                 
Symbol
APC11
Name
(RefSeq) anaphase promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YDL008W (APC11)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDL008W (APC11)
   04113 Meiosis - yeast
    YDL008W (APC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YDL008W (APC11)
   03036 Chromosome and associated proteins [BR:sce03036]
    YDL008W (APC11)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     YDL008W (APC11)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    YDL008W (APC11)
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-RING_4 Tocopherol_cycl UBZ_FAAP20
Other DBs
NCBI-GeneID: 851554
NCBI-ProteinID: NP_010276
SGD: S000002166
UniProt: Q12157
Structure
LinkDB
Position
IV:433497..433994
AA seq 165 aa
MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD
QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR
RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR
NT seq 498 nt   +upstreamnt  +downstreamnt
atgaaagttaaaataaacgaagtgcacagtgtgtttgcttggtcatggcacatccctagc
acatctgatgaggacgcagccaataacgatccaattggcaatgatgaagacgaggatgtc
tgtggtatctgtcgtgccagttataacggtacctgtccaagctgtaaatttccaggcgat
caatgccctttagtgattgggctatgtcatcataacttccatgatcattgtatataccgt
tggcttgatacaccaacctcaaaaggactgtgtccgatgtgtaggcaaactttccagcta
cagaagggtctagcaattaatgacgctcatgtccaaaagttcgttgaaatagtttcaaga
agaagagaagaaatgatagaggagggcgtcgcagaagagtttgtggactttgatgaacca
ataaggcaaaacaccgataacccaatcggtagacagcaagttgataccatcctggacgaa
gactttttgttacgataa

DBGET integrated database retrieval system