KEGG   Saccharomyces cerevisiae (budding yeast): YDL059C
Entry
YDL059C           CDS       T00005                                 
Symbol
RAD59
Name
(RefSeq) Rad59p
  KO
K10959  DNA repair protein RAD59
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YDL059C (RAD59)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YDL059C (RAD59)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad52 family proteins
     YDL059C (RAD59)
SSDB
Motif
Pfam: Rad52_Rad22
Other DBs
NCBI-GeneID: 851500
NCBI-ProteinID: NP_010224
SGD: S000002217
UniProt: Q12223
LinkDB
Position
IV:complement(344237..344953)
AA seq 238 aa
MTIQAKPSSSISYDSTTYGTAPGLDIKEFQIIEDWNGRPASAWSVQRIGLLQSKIERYTY
NIYHNNKYGKHNLSKLIPGHALIQFANETFGYDGWRMDVIDVEARECQPFTAVNNGENTN
TSEVKYTVVAEAQVKVTLKDGTNTQCGGLGRITLSSRGECYNRSKKEAVGDALKKALLSF
EKIILDYETKITNNYYVDGLYGSKKIKNEANTNYNLLSATNSKPTFIKLEDAKGTHIK
NT seq 717 nt   +upstreamnt  +downstreamnt
atgacgatacaagcgaagcccagttcgagcatatcgtatgattcgactacatacggcaca
gcaccgggcttggatataaaagagttccaaatcatcgaagattggaatggaagacctgcc
agcgcttggtcggtgcagaggattgggcttctacagtccaagatcgaaaggtacacgtac
aatatttaccacaataataaatatgggaagcacaacttatctaagctgataccagggcat
gctctcattcagttcgctaatgaaacattcgggtatgatggttggcgaatggatgttata
gatgttgaggcccgggagtgccagcccttcaccgcagtaaataatggagaaaacaccaac
actagtgaggtcaagtatacagttgtggcagaagcccaagtaaaggttaccttaaaggat
ggcaccaacacacagtgtggtgggctaggtagaattactttgtcctcgagaggtgaatgt
tataacaggtcgaaaaaagaggctgtaggcgatgcgttaaagaaggcgttattgagcttt
gaaaaaatcatactcgattatgagactaagattacaaataattactatgtcgatggcttg
tatggctcaaaaaaaattaaaaatgaagctaacaccaattacaacttattgtcagcgact
aatagcaagccgacttttatcaaattggaggatgctaaaggcacgcatatcaaataa

DBGET integrated database retrieval system