KEGG   Saccharomyces cerevisiae (budding yeast): YDL088C
Entry
YDL088C           CDS       T00005                                 
Symbol
ASM4, NUP59
Name
(RefSeq) FG-nucleoporin ASM4
  KO
K18717  nucleoporin ASM4
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  Nucleocytoplasmic transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    YDL088C (ASM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YDL088C (ASM4)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YDL088C (ASM4)
SSDB
Motif
Pfam: Nup35_RRM Nup35_RRM_2
Other DBs
NCBI-GeneID: 851470
NCBI-ProteinID: NP_010195
SGD: S000002246
UniProt: Q05166
Structure
LinkDB
Position
IV:complement(298417..300003)
AA seq 528 aa
MFGIRSGNNNGGFTNLTSQAPQTTQMFQSQSQLQPQPQPQPQQQQQHLQFNGSSDASSLR
FGNSLSNTVNANNYSSNIGNNSINNNNIKNGTNNISQHGQGNNPSWVNNPKKRFTPHTVI
RRKTTKQNSSSDINQNDDSSSMNATMRNFSKQNQDSKHNERNKSAANNDINSLLSNFNDI
PPSVTLQDWQREDEFGSIPSLTTQFVTDKYTAKKTNRSAYDSKNTPNVFDKDSYVRIANI
EQNHLDNNYNTAETNNKVHETSSKSSSLSAIIVFGYPESISNELIEHFSHFGHIMEDFQV
LRLGRGINPNTFRIFHNHDTGCDENDSTVNKSITLKGRNNESNNKKYPIFTGESWVKLTY
NSPSSALRALQENGTIFRGSLIGCIPYSKNAVEQLAGCKIDNVDDIGEFNVSMYQNSSTS
STSNTPSPPNVIITDGTLLREDDNTPAGHAGNPTNISSPIVANSPNKRLDVIDGKLPFMQ
NAGPNSNIPNLLRNLESKMRQQEAKYRNNEPAGFTHKLSNWLFGWNDL
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgtttggaatacgttcaggcaataataacggtggatttactaacctcacgtcgcaagca
ccacagacaacccagatgtttcaatcgcaatcacagttgcagccacaaccgcaaccgcaa
ccacaacaacagcagcaacacttgcaattcaatggatcatccgatgcaagttctttacga
tttggaaactcactttccaatactgtaaacgccaataactatagtagtaatatcggtaac
aatagcatcaacaacaacaacattaaaaacggcacaaataacataagccaacatggccaa
gggaataatcctagctgggtgaataatcctaaaaagagattcactcctcatacggtgata
agaaggaagacaacaaagcaaaattcttcttctgacatcaaccagaatgatgattcatct
tctatgaacgctactatgagaaatttcagtaagcaaaatcaagattccaagcataatgaa
agaaataagtctgcggcaaataatgacatcaattctctgttgtcaaattttaacgatatt
ccaccctccgttactttacaggattggcaacgcgaggatgaattcggttctattccatca
ttaacaactcagtttgttaccgacaaatacacggcgaagaaaacaaataggtcagcttat
gattccaaaaatactccaaatgtttttgataaagactcttatgttagaatagcaaacatt
gaacagaaccatttagataataattacaacaccgccgaaacaaacaataaagtccatgaa
acatcttccaagtcttctagtttgagcgcaattatcgtatttggctatcctgaatcaatt
tccaatgaattgattgaacacttctcccatttcggtcatattatggaagactttcaagta
ttgcgattgggtcgcgggattaaccccaacaccttcagaatattccataatcatgataca
ggctgtgatgaaaacgattctactgttaataaatctattactttaaaaggcagaaataat
gagtcgaataacaaaaaatatccaatatttactggtgaaagttgggtcaaactcacttat
aattctccatcttctgctttgagagcactgcaggaaaatggaaccatatttcgcggttct
ttgattggttgcatcccatattcaaaaaatgcggtggagcaattagctggctgcaaaatt
gataatgtcgacgacattggagaattcaacgtttctatgtatcaaaattcctccacatcg
tcgacatctaatacaccatccccaccaaacgtaataataactgatggcactcttctgagg
gaagacgataatactcctgccggtcatgctggtaatccaacaaatatttcaagtccaata
gtagcaaattctccgaataagcggctggatgtaatagatggcaaattgccattcatgcaa
aatgcaggaccgaattcgaatattcctaatctgttgcgaaacctagaatcgaaaatgcgt
cagcaagaagcgaaatacagaaataatgaacctgctggttttacgcacaaactgagtaat
tggttatttggttggaatgacctataa

DBGET integrated database retrieval system