KEGG   Saccharomyces cerevisiae (budding yeast): YDL102W
Entry
YDL102W           CDS       T00005                                 
Symbol
POL3, CDC2, HPR6, TEX1
Name
(RefSeq) DNA-directed DNA polymerase delta POL3
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03410  Base excision repair
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YDL102W (POL3)
   03410 Base excision repair
    YDL102W (POL3)
   03420 Nucleotide excision repair
    YDL102W (POL3)
   03430 Mismatch repair
    YDL102W (POL3)
   03440 Homologous recombination
    YDL102W (POL3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YDL102W (POL3)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YDL102W (POL3)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YDL102W (POL3)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    YDL102W (POL3)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      YDL102W (POL3)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     YDL102W (POL3)
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2 DNA_pol_B_exo2 divDNApol
Other DBs
NCBI-GeneID: 851456
NCBI-ProteinID: NP_010181
SGD: S000002260
UniProt: P15436
Structure
LinkDB
Position
IV:276872..280165
AA seq 1097 aa
MSEKRSLPMVDVKIDDEDTPQLEKKIKRQSIDHGVGSEPVSTIEIIPSDSFRKYNSQGFK
AKDTDLMGTQLESTFEQELSQMEHDMADQEEHDLSSFERKKLPTDFDPSLYDISFQQIDA
EQSVLNGIKDENTSTVVRFFGVTSEGHSVLCNVTGFKNYLYVPAPNSSDANDQEQINKFV
HYLNETFDHAIDSIEVVSKQSIWGYSGDTKLPFWKIYVTYPHMVNKLRTAFERGHLSFNS
WFSNGTTTYDNIAYTLRLMVDCGIVGMSWITLPKGKYSMIEPNNRVSSCQLEVSINYRNL
IAHPAEGDWSHTAPLRIMSFDIECAGRIGVFPEPEYDPVIQIANVVSIAGAKKPFIRNVF
TLNTCSPITGSMIFSHATEEEMLSNWRNFIIKVDPDVIIGYNTTNFDIPYLLNRAKALKV
NDFPYFGRLKTVKQEIKESVFSSKAYGTRETKNVNIDGRLQLDLLQFIQREYKLRSYTLN
AVSAHFLGEQKEDVHYSIISDLQNGDSETRRRLAVYCLKDAYLPLRLMEKLMALVNYTEM
ARVTGVPFSYLLARGQQIKVVSQLFRKCLEIDTVIPNMQSQASDDQYEGATVIEPIRGYY
DVPIATLDFNSLYPSIMMAHNLCYTTLCNKATVERLNLKIDEDYVITPNGDYFVTTKRRR
GILPIILDELISARKRAKKDLRDEKDPFKRDVLNGRQLALKISANSVYGFTGATVGKLPC
LAISSSVTAYGRTMILKTKTAVQEKYCIKNGYKHDAVVVYGDTDSVMVKFGTTDLKEAMD
LGTEAAKYVSTLFKHPINLEFEKAYFPYLLINKKRYAGLFWTNPDKFDKLDQKGLASVRR
DSCSLVSIVMNKVLKKILIERNVDGALAFVRETINDILHNRVDISKLIISKTLAPNYTNP
QPHAVLAERMKRREGVGPNVGDRVDYVIIGGNDKLYNRAEDPLFVLENNIQVDSRYYLTN
QLQNPIISIVAPIIGDKQANGMFVVKSIKINTGSQKGGLMSFIKKVEACKSCKGPLRKGE
GPLCSNCLARSGELYIKALYDVRDLEEKYSRLWTQCQRCAGNLHSEVLCSNKNCDIFYMR
VKVKKELQEKVEQLSKW
NT seq 3294 nt   +upstreamnt  +downstreamnt
atgagtgaaaaaagatcccttcccatggttgatgtgaagatcgatgacgaggatactccc
cagttggaaaagaaaatcaaacggcaatcaatagatcatggtgttggaagtgaacctgtt
tcaacaatagagattattccgagtgattcttttcgaaaatataatagtcaaggcttcaaa
gcaaaggatacagatttaatgggtacgcaattagagtctacttttgaacaagagctatcg
caaatggaacatgatatggccgaccaagaagagcatgacctgtcatcattcgagcgtaag
aaacttccaaccgattttgacccaagtttgtatgatatttctttccaacaaattgatgcg
gaacagagcgtactgaatggtatcaaagatgaaaatacatctaccgtggtaaggtttttt
ggtgtcactagtgaaggacactctgtactttgtaatgttacagggttcaagaactatctt
tacgtcccagcgcccaattcttccgacgctaacgatcaggagcaaatcaacaagtttgtg
cactatttaaacgaaacatttgaccacgctattgattcgattgaagttgtatctaaacag
tctatctggggttattccggagataccaaattaccattctggaaaatatacgtcacctat
ccgcatatggtcaacaaactgcgtactgcgtttgaaagaggtcatctttcattcaactcg
tggttttctaacggcacgactacttatgataacattgcctacactttaaggttaatggta
gattgtggaattgtcggtatgtcctggataacattaccaaaaggaaagtattcgatgatt
gagcctaataacagagtttcctcttgtcagttggaagtttcaattaattatcgtaaccta
atagcacatcctgctgagggtgattggtctcatacagctccattgcgtatcatgtccttt
gatatcgagtgtgctggtaggattggcgtctttccggaacctgaatacgatcccgtcatc
caaattgccaacgttgtgagtattgctggcgctaagaaaccattcattcgtaatgtgttt
actctgaatacatgctcacccataacaggttcaatgattttttcccacgccactgaagag
gaaatgttgagcaattggcgtaactttatcatcaaagttgatcctgatgttatcattggt
tataatactacaaattttgatatcccttatcttttaaaccgtgcaaaggcgctaaaggtg
aatgatttcccatattttggaaggttaaaaaccgttaagcaagaaattaaagagtctgtg
ttctcttcgaaggcttatggtacaagagaaaccaaaaatgtcaatattgacggccgatta
cagttggatcttttgcaatttattcagcgtgagtataaactaagatcctacacgttgaat
gcagtctctgcgcactttttaggtgaacagaaggaggatgtacattatagcatcatttct
gatctacaaaatggcgatagtgaaacaagaagaaggttggccgtttactgtttgaaagac
gcctacctgcctttaaggcttatggaaaaactaatggcgttagttaactatacagaaatg
gctcgtgttacaggtgtgccattttcatatttactagctcgtggtcaacaaattaaagtt
gtttctcaactatttcgaaagtgcctggagattgatactgtgatacctaacatgcaatct
caggcctctgatgaccaatatgagggtgccactgttattgagcctattcgtggttattac
gatgtaccgattgcaactttggatttcaattctttatatccaagtattatgatggcgcac
aacctatgttatacaacactttgtaacaaagctactgtagagagattgaatcttaaaatt
gacgaagactacgtcataacacctaatggagattattttgttaccacaaaaagaaggcgt
ggtatattaccaattattctggatgaattaataagtgctagaaaacgcgctaaaaaagat
ctgagagatgagaaggatccattcaaaagagatgttttaaatggtagacaattggctttg
aagatttcagctaactctgtctatggttttacaggagcgacggtgggtaaattgccatgt
ttagccatttcttcatctgttactgcttatggtcgtaccatgattttaaaaactaaaacc
gcagtccaagaaaaatattgtataaagaatggttataagcacgatgccgttgtggtttac
ggtgacactgattccgttatggtaaagtttggtacaacagatttaaaggaagctatggat
cttggtaccgaagctgccaaatatgtctccactctattcaaacatccgattaacttagaa
tttgaaaaagcatacttcccttaccttttgataaataaaaagcgttatgcaggtttattc
tggactaatcctgacaagtttgacaagttggaccaaaaaggccttgcttctgtccgtcgt
gattcctgttccttggtttctattgttatgaataaagttttaaagaaaattttaattgaa
agaaatgtagatggtgctttagcttttgtcagagaaactatcaatgatattctgcataat
agagtagatatttcaaagttgattatatcaaagacgttagccccaaattacacaaatcca
cagccgcacgccgttttggctgaacgtatgaagaggagagagggcgttggtccaaatgtt
ggtgatcgtgtggactatgtcattatcggtggtaatgataaactttacaatagagcagaa
gatccattatttgtactagaaaacaatattcaagtggattcgcgctattatttaactaat
caattacaaaatccaatcattagtattgttgcacctattattggcgacaaacaggcgaac
ggtatgttcgttgtgaaatccattaaaattaacacaggctctcaaaaaggaggcttgatg
agctttattaaaaaagttgaggcttgtaaaagttgtaaaggtccgttgaggaaaggtgaa
ggccctctttgttcaaactgtctagcaaggtctggagaattatacataaaggcattatac
gatgtcagagatttagaggaaaaatactcaagattatggacacaatgccaaaggtgcgct
ggtaacttacatagtgaagttttgtgttcaaataagaactgtgacattttttatatgcgg
gttaaggttaaaaaagagctgcaggagaaagtagaacaattaagcaaatggtaa

KEGG   Saccharomyces cerevisiae (budding yeast): YJR006W
Entry
YJR006W           CDS       T00005                                 
Symbol
POL31, HUS2, HYS2, SDP5
Name
(RefSeq) DNA-directed DNA polymerase delta subunit POL31
  KO
K02328  DNA polymerase delta subunit 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03410  Base excision repair
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YJR006W (POL31)
   03410 Base excision repair
    YJR006W (POL31)
   03420 Nucleotide excision repair
    YJR006W (POL31)
   03430 Mismatch repair
    YJR006W (POL31)
   03440 Homologous recombination
    YJR006W (POL31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YJR006W (POL31)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YJR006W (POL31)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    YJR006W (POL31)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      YJR006W (POL31)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     YJR006W (POL31)
SSDB
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N
Other DBs
NCBI-GeneID: 853462
NCBI-ProteinID: NP_012539
SGD: S000003766
UniProt: P46957
Structure
LinkDB
Position
X:449202..450665
AA seq 487 aa
MDALLTKFNEDRSLQDENLSQPRTRVRIVDDNLYNKSNPFQLCYKKRDYGSQYYHIYQYR
LKTFRERVLKECDKRWDAGFTLNGQLVLKKDKVLDIQGNQPCWCVGSIYCEMKYKPNVLD
EVINDTYGAPDLTKSYTDKEGGSDEIMLEDESGRVLLVGDFIRSTPFITGVVVGILGMEA
EAGTFQVLDICYPTPLPQNPFPAPIATCPTRGKIALVSGLNLNNTSPDRLLRLEILREFL
MGRINNKIDDISLIGRLLICGNSVDFDIKSVNKDELMISLTEFSKFLHNILPSISVDIMP
GTNDPSDKSLPQQPFHKSLFDKSLESYFNGSNKEILNLVTNPYEFSYNGVDVLAVSGKNI
NDICKYVIPSNDNGESENKVEEGESNDFKDDIEHRLDLMECTMKWQNIAPTAPDTLWCYP
YTDKDPFVLDKWPHVYIVANQPYFGTRVVEIGGKNIKIISVPEFSSTGMIILLDLETLEA
ETVKIDI
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggacgcattgttaacaaagttcaacgaggatagaagtctccaagatgaaaacttgtcc
caaccacgaacgagagtaagaattgttgacgacaatctttacaacaaatcgaatccattc
caactatgctataaaaaacgtgactacggttctcagtactaccacatttatcaataccgt
ctaaagactttcagagaacgcgtcttaaaagaatgtgacaagagatgggatgcgggcttt
accttgaatggccaattagttctaaaaaaggacaaagtgttagatattcagggaaaccaa
ccatgttggtgcgtaggatccatatattgcgagatgaaatataaaccaaacgtactggac
gaagtgatcaatgatacatatggtgcaccagatttaactaaaagttatactgataaagag
ggtggttctgatgaaattatgctcgaagatgaaagtgggagagtgcttctagtgggagat
tttattcggtctacacccttcatcacgggtgttgttgtaggtatactgggtatggaagct
gaagccgggacatttcaagttttagacatatgctaccccactcctttaccacaaaatcct
ttccctgcaccaattgctacctgccccaccaggggaaaaattgctcttgtttctgggtta
aacctcaataatacatcacctgataggctattgagattggagattttgagagaatttttg
atggggagaatcaataacaaaattgacgacatttctctaattggtagattactgatatgc
ggcaactctgttgacttcgacattaaaagcgtgaacaaagacgaattgatgatttctcta
actgagttcagtaaatttctacacaacattttgccatctatatctgttgatattatgccc
ggaaccaatgatccaagtgacaaatctctaccgcaacagcctttccacaaatcattgttt
gataagtccctagaatcatacttcaacggttctaacaaagaaattttgaatttagtgacc
aacccatatgagtttagctataatggcgtagacgttctagccgtttcaggcaaaaatatc
aatgatatttgtaaatacgtaataccatcaaatgataacggagaaagtgaaaacaaggtc
gaggagggcgagagtaatgatttcaaagacgatatagagcatcgcctggaccttatggaa
tgtacaatgaaatggcaaaacatcgcgcccaccgcacctgataccttatggtgttatccg
tacactgataaggatccatttgtattggataagtggccccacgtttacattgtggcaaac
cagccatattttggaacaagagtagtggaaataggtggtaagaacataaagataatatct
gtccctgaattcagttctactgggatgataatattactggatttggaaacgttagaagca
gagacggtcaagattgacatttaa

KEGG   Saccharomyces cerevisiae (budding yeast): YJR043C
Entry
YJR043C           CDS       T00005                                 
Symbol
POL32, REV5
Name
(RefSeq) DNA polymerase delta subunit POL32
  KO
K03504  DNA polymerase delta subunit 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03410  Base excision repair
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YJR043C (POL32)
   03410 Base excision repair
    YJR043C (POL32)
   03420 Nucleotide excision repair
    YJR043C (POL32)
   03430 Mismatch repair
    YJR043C (POL32)
   03440 Homologous recombination
    YJR043C (POL32)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YJR043C (POL32)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YJR043C (POL32)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YJR043C (POL32)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YJR043C (POL32)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    YJR043C (POL32)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      YJR043C (POL32)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     YJR043C (POL32)
SSDB
Motif
Pfam: CDC27
Other DBs
NCBI-GeneID: 853500
NCBI-ProteinID: NP_012577
SGD: S000003804
UniProt: P47110
Structure
LinkDB
Position
X:complement(516461..517513)
AA seq 350 aa
MDQKASYFINEKLFTEVKPVLFTDLIHHLKIGPSMAKKLMFDYYKQTTNAKYNCVVICCY
KDQTIKIIHDLSNIPQQDSIIDCFIYAFNPMDSFIPYYDIIDQKDCLTIKNSYELKVSES
SKIIERTKTLEEKSKPLVRPTARSKTTPEETTGRKSKSKDMGLRSTALLAKMKKDRDDKE
TSRQNELRKRKEENLQKINKQNPEREAQMKELNNLFVEDDLDTEEVNGGSKPNSPKETDS
NDKDKNNDDLEDLLETTAEDSLMDVPKIQQTKPSETEHSKEPKSEEEPSSFIDEDGYIVT
KRPATSTPPRKPSPVVKRALSSSKKQETPSSNKRLKKQGTLESFFKRKAK
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggatcaaaaggcgtcatattttatcaatgagaagctcttcactgaggtaaagcccgtc
ctttttacggatctaattcaccacttgaagatcggcccatccatggccaagaaattaatg
tttgactattacaaacagaccaccaatgccaaatacaactgcgtagtgatatgctgctac
aaagatcaaactattaaaattattcatgatctttccaacattccacagcaagattcaata
attgattgtttcatctatgccttcaatcccatggacagcttcataccatattacgacatt
atcgatcaaaaggattgtttaaccattaaaaattcatacgaacttaaagtttctgaatca
tcgaaaattatagagaggactaagacgttagaagagaaatctaaacctttggtaaggcct
acagcaagatcaaagaccacgccagaagaaacaaccggaaggaaatccaaatctaaagac
atgggtctcaggtctactgcactgctggctaagatgaaaaaggatagagatgacaaggaa
acctctagacaaaatgagttacgtaaaaggaaagaggagaacttgcaaaaaataaataaa
cagaaccctgaaagagaagctcaaatgaaagagttaaataatctttttgtcgaagatgac
ttagatacagaggaagtaaatggagggtccaagcccaactcacctaaagaaactgacagc
aacgataaggacaaaaacaacgatgatttagaagacttgttggaaacgacagcagaagat
tcacttatggatgtacctaaaatacagcaaacaaagccttctgaaacagaacattcaaag
gaacctaaatctgaagaagagccctcctcttttattgatgaggatggatatattgtgaca
aagagacccgcaacttcaacaccaccacgcaagccatcacccgtggtaaaaagggcattg
tcgtcttcaaaaaagcaagaaacgccgtcatcgaataaaaggttaaaaaagcaaggaaca
ttggaaagctttttcaaaagaaaggcaaaataa

DBGET integrated database retrieval system