KEGG   Saccharomyces cerevisiae (budding yeast): YDL132W
Entry
YDL132W           CDS       T00005                                 
Symbol
CDC53
Name
(RefSeq) cullin CDC53
  KO
K03347  cullin 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04120  Ubiquitin mediated proteolysis
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YDL132W (CDC53)
   04120 Ubiquitin mediated proteolysis
    YDL132W (CDC53)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDL132W (CDC53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YDL132W (CDC53)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     YDL132W (CDC53)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 Penicillinase_R
Other DBs
NCBI-GeneID: 851424
NCBI-ProteinID: NP_010150
SGD: S000002290
UniProt: Q12018
Structure
LinkDB
Position
IV:224304..226751
AA seq 815 aa
MSETLPRSDDLEATWNFIEPGINQILGNEKNQASTSKRVYKILSPTMYMEVYTAIYNYCV
NKSRSSGHFSTDSRTGQSTILVGSEIYEKLKNYLKNYILNFKQSNSETFLQFYVKRWKRF
TIGAIFLNHAFDYMNRYWVQKERSDGKRHIFDVNTLCLMTWKEVMFDPSKDVLINELLDQ
VTLGREGQIIQRSNISTAIKSLVALGIDPQDLKKLNLNVYIQVFEKPFLKKTQEYYTQYT
NDYLEKHSVTEYIFEAHEIIKREEKAMTIYWDDHTKKPLSMALNKVLITDHIEKLENEFV
VLLDARDIEKITSLYALIRRDFTLIPRMASVFENYVKKTGENEISSLLAMHKHNIMKNEN
ANPKKLALMTAHSLSPKDYIKKLLEVHDIFSKIFNESFPDDIPLAKALDNACGAFININE
FALPAGSPKSATSKTSEMLAKYSDILLKKATKPEVASDMSDEDIITIFKYLTDKDAFETH
YRRLFAKRLIHGTSTSAEDEENIIQRLQAANSMEYTGKITKMFQDIRLSKILEDDFAVAL
KNEPDYSKAKYPDLQPFVLAENMWPFSYQEVEFKLPKELVPSHEKLKESYSQKHNGRILK
WLWPLCRGELKADIGKPGRMPFNFTVTLFQMAILLLYNDADVLTLENIQEGTSLTIQHIA
AAMVPFIKFKLIQQVPPGLDALVKPETQFKLSRPYKALKTNINFASGVKNDILQSLSGGG
HDNHGNKLGNKRLTEDERIEKELNTERQIFLEACIVRIMKAKRNLPHTTLVNECIAQSHQ
RFNAKVSMVKRAIDSLIQKGYLQRGDDGESYAYLA
NT seq 2448 nt   +upstreamnt  +downstreamnt
atgtctgagactctgcctagatctgatgatttagaggccacttggaactttatagagcca
ggaattaaccaaatactgggtaatgagaaaaaccaagcatccacgtctaagcgagtttac
aaaattctttctccaaccatgtatatggaagtctataccgcaatttataactactgtgtg
aacaaatcacgctcgtctggacattttagtactgacagtagaactggccaatcaacaatt
ttggttggcagtgagatttacgaaaagttaaagaattatttgaagaattacattttaaat
tttaagcagtctaattcagagacctttttgcagttttacgtcaagcgctggaaaaggttt
acaataggtgccatttttttaaaccatgcattcgattatatgaatagatattgggttcaa
aaggaaagaagtgacggcaaaaggcatatttttgatgtaaacaccttgtgcttgatgaca
tggaaagaagtcatgtttgatccgagtaaagatgttttaataaacgaattattagaccag
gtaaccttgggaagggaggggcaaataattcaaagaagtaatattagcactgccataaag
tctttagttgcactaggtatcgatccacaggatttgaaaaagttgaacctaaatgtctac
atccaagttttcgaaaagccatttttaaagaagactcaggagtactacacgcaatataca
aacgattatttagagaaacactcggtaactgagtatatttttgaagcacatgaaatcatc
aaacgtgaggaaaaagcaatgacaatatattgggatgatcatacaaaaaaaccactatcc
atggcattaaacaaggtcttgatcacagaccatattgaaaagttggaaaatgagtttgtt
gtccttctggatgccagagatattgaaaaaattacttctttgtacgcactaatacgcaga
gactttacattaatcccaagaatggcttcagtgtttgaaaattatgttaaaaagacaggt
gagaatgaaatttcgagtctactggcaatgcataaacacaatattatgaaaaacgaaaac
gcaaaccctaaaaaactagcactaatgacagctcactccctttctcctaaagactatatc
aagaaattactggaagtacacgatatattctctaagatttttaatgaaagtttccccgac
gacatacctttagctaaagctctagataatgcgtgtggtgctttcatcaacatcaacgag
ttcgcattacctgctggatctccaaaaagtgccacctcgaagacttccgagatgctagct
aagtacagtgatatactattaaagaaggccaccaaacctgaagtggcaagtgacatgtca
gatgaagatattataacaatattcaaatatttgaccgacaaagatgcgttcgaaactcat
tatagaagacttttcgccaagcgtttaattcatggcacttcaacatcagcagaagacgaa
gaaaatattattcaaaggctgcaagcggcaaatagtatggaatatacaggcaagataact
aaaatgtttcaagatattagactttccaagatcttggaagacgattttgctgtcgccctg
aagaatgaaccagattactctaaagcaaaatatccagatctacaaccatttgtattggca
gaaaatatgtggccattttcataccaagaagttgaatttaagctacccaaggaattggta
ccatctcacgaaaaattgaaggagtcatacagccaaaagcataatggtagaatattgaag
tggctatggccattatgtcgtggcgaattgaaggcagatattggaaaacccggcaggatg
ccgttcaactttacggtaacactgtttcaaatggcaattttgctactatataacgatgct
gatgtattaaccttagaaaatattcaagagggcacgagcttaaccattcagcacatcgca
gcggcaatggtaccattcatcaaattcaaactgattcaacaggtcccaccagggctagat
gctctcgtgaaacctgaaacacaattcaagctatcacgtccttataaggcgcttaagacc
aatattaatttcgctagcggagtcaaaaacgacattctgcaatcgctatccggtggaggc
cacgataatcacggtaataagttaggaaacaaacgcttgacggaagacgaaagaatagaa
aaagaattgaatacagaaaggcagattttcttggaagcttgtattgtgagaataatgaaa
gcgaaaagaaatctgccacatacaacattggtcaacgaatgcattgcgcaatcacaccaa
aggttcaatgcaaaggtttctatggtcaagagagccatcgatagcttaatacaaaaggga
tacctacagaggggagacgatggtgaatcgtatgcttaccttgcttaa

DBGET integrated database retrieval system