KEGG   Saccharomyces cerevisiae (budding yeast): YDR030C
Entry
YDR030C           CDS       T00005                                 
Symbol
RAD28
Name
(RefSeq) Rad28p
  KO
K10570  DNA excision repair protein ERCC-8
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03420  Nucleotide excision repair
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YDR030C (RAD28)
  09124 Replication and repair
   03420 Nucleotide excision repair
    YDR030C (RAD28)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YDR030C (RAD28)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YDR030C (RAD28)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     YDR030C (RAD28)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      YDR030C (RAD28)
SSDB
Motif
Pfam: WD40 NBCH_WD40
Other DBs
NCBI-GeneID: 851594
NCBI-ProteinID: NP_010313
SGD: S000002437
UniProt: Q12021
LinkDB
Position
IV:complement(501753..503273)
AA seq 506 aa
MDPFLEFRVGNISLNEFYRRTIQSEFERILEDPLSNMKNYRFSKQSNYSTKEKTPLSIGV
NCLDIDDTGQVLLGGGDDGSLSIWGLDESLHRNDEGEQELINKRLNYIKRQPHQSDDEPA
QIMGYKNKRTRINDNNTMRLVHSFQTQRNKYRMYRQSSAAVPVQRSHISNKTDSPIGFSE
TLSETDSEASISHHKYGITTLKWYKADNGMFFTGSNDKTVKIWDTNRFEAVQDINLGYKI
NQIDNNVVDDSSLLVVASEDYYPRLIDLRTMNSGVTALGMGNQTRMQSEILCCKFNPVRE
QIIACGDMEGGVKLWDLRMRNRLYSELKRNKNRFKTINNDDNDDQSDVYFSSNQSKAHLR
CCSDIVWNSEGSELCSVGMDGKLNVWRPFTEILQPEGLASYSQLGTQDLSRIKYKKRVSR
RLLWFDKFLLCITDNGEVEIYNTEEKKLWNKLEYPMVNQVKKNQASHCQFSSMIVQTNIM
NSVGLKLFFGTNNNTVSDGGSIFECS
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggatccatttttagagttcagagtaggcaatatctcattaaatgaattttatagaaga
actattcaaagcgaatttgagaggatccttgaagatcccctatcaaatatgaaaaactac
agatttagtaaacaatcaaactatagtacaaaagaaaaaacaccgttaagtataggtgtt
aactgtcttgatattgatgatactggtcaagtgttattaggaggtggagatgatgggtca
ctttccatttggggtttagatgaatcattgcaccgcaatgatgaaggtgaacaggaattg
atcaataaaaggctaaactatatcaagcgacagcctcaccaatcagatgatgagcctgct
caaataatgggttataaaaataaaagaacacgaataaacgacaacaacactatgagactg
gtgcacagttttcaaacacagagaaacaaatatcgaatgtatagacagtctagtgctgca
gttccagttcaaagatcacacatatcaaataaaacggattctcctatcgggtttagtgag
acactatctgaaacagattcagaagcttccatatctcaccataaatatggtataacaact
ttgaagtggtataaggctgataatgggatgttttttactggctcaaatgataaaactgta
aaaatatgggacacaaacaggtttgaagcggttcaagatataaacctggggtataaaata
aatcaaattgataataacgttgtcgacgacagttctttgcttgtagtggcaagtgaagac
tactatccaagattaattgacctgagaaccatgaattcaggggtaactgcgcttggaatg
ggaaatcaaacacgaatgcaatcagaaattttatgctgcaaatttaaccccgtcagggaa
cagattattgcttgtggtgacatggagggtggggtaaaattatgggatctaagaatgagg
aacagactgtattcagaattgaaaagaaataaaaataggttcaagactataaataacgat
gataatgacgatcaaagcgatgtctatttcagctctaaccaatcaaaagcccatctgaga
tgttgcagtgacattgtttggaatagtgagggttcagagctatgttcagtcggcatggat
ggaaaactgaatgtttggaggccatttacggaaattctgcaaccagaaggtctagctagt
tattcccagttgggaacacaagacctgagccgtatcaaatacaaaaaaagagtatctcga
aggttgctttggtttgacaagtttttactgtgtattactgacaatggtgaagtagaaata
tacaatacggaggaaaaaaaactttggaacaagctcgaatacccaatggttaatcaggta
aaaaaaaatcaggcttcgcattgtcagtttagttccatgattgtgcaaacaaatataatg
aattcagttggcctcaaattgttctttggaactaacaacaacaccgttagcgacggcgga
tccatctttgaatgttcataa

DBGET integrated database retrieval system