KEGG   Saccharomyces cerevisiae (budding yeast): YDR076W
Entry
YDR076W           CDS       T00005                                 
Symbol
RAD55
Name
(RefSeq) putative DNA-dependent ATPase RAD55
  KO
K10957  DNA repair protein RAD55
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YDR076W (RAD55)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YDR076W (RAD55)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     YDR076W (RAD55)
SSDB
Motif
Pfam: ATPase Rad51 AAA_25 AAA_18
Other DBs
NCBI-GeneID: 851648
NCBI-ProteinID: NP_010361
SGD: S000002483
UniProt: P38953
LinkDB
Position
IV:598468..599688
AA seq 406 aa
MSLGIPLSQLIVESPKPLSSGITGLDEILNLGFQARSIYEIFGPPGIGKTNFGIQLVCNS
LEGIQQSEINDDKILWIETFQEMPINILRERFQKFKIVEENVKRVRITKFGQLLYFFQNL
FKLSQSVRYKLVIIDGFSQLVCDHLCTLSKRGGGMIDKTIHELKCRHLILIFTVMTKYTH
STGSTIIVLNDCMNTAFQSNEFESLEEYYEILDDGSNFFVNSNNERRKNNVHILKSALVA
NIAMGSKDSTWEVFLRDRIGLFRDWNEQVDETVFVKSKRVKASSSQSNEGCTTIKEMRIN
KRNFENLRIAIVFNLHGEDRKREGRNLKRSRSSDDRNYIVKFDFDKATGQLRDIIDLKPD
TANIASFPTLSTSSSSCSQVFNNIDSNDNPLPNAEGKEEIIYDSEG
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgtcgcttggtataccactttcccaattaatagtagaaagtccaaagccattaagtagc
ggcatcacaggattagatgagatattaaacctgggattccaggcaaggtcgatctacgaa
atatttgggcctccgggcattggcaagactaattttggcattcaattggtgtgtaattcg
ttagaaggcatacaacaatcggaaataaacgacgataaaattctatggatagaaacattt
caagaaatgcccataaacatactaagagaacgctttcaaaaatttaaaatcgtggaagaa
aatgtgaagcgggtccgaataacgaaatttggacagctattatatttcttccagaatttg
ttcaaattatctcaaagtgtgcgatataaactagttataattgatggattttctcaatta
gtctgcgatcatctgtgtacactaagtaaaagaggcggcggaatgatagataaaactata
cacgagttaaaatgtcgacatttgatattaatttttacggtaatgaccaaatacacacat
tccacgggttcgacaataatagttttaaatgactgtatgaacaccgccttccaatcaaac
gaattcgaatccttggaagaatactacgaaattttagacgacggatctaacttctttgtc
aactctaacaacgaaaggcgtaagaacaatgtacatatattgaaaagcgcgctcgttgcc
aatatcgctatgggaagcaaggattccacttgggaagtatttctaagagacaggatcggc
ctttttagggattggaatgaacaagtggacgaaaccgttttcgtgaaaagcaaaagagtg
aaggcgtcatcctcgcagagtaacgagggatgtactaccatcaaagaaatgagaataaac
aaacgaaactttgaaaacttgagaatagctattgtttttaatttacacggcgaagataga
aaaagagaaggacgaaatttaaagcggtcaagaagcagcgacgatcgtaactatattgtc
aaatttgattttgataaagcaacaggtcaactccgcgatataattgatctgaaacctgat
actgctaatattgcctcatttccaacattatcaacaagcagcagcagttgctcacaagtg
tttaacaatattgactccaatgataatccattaccaaatgcggagggaaaggaggagata
atttatgatagtgaaggttaa

DBGET integrated database retrieval system