KEGG   Saccharomyces cerevisiae (budding yeast): YDR097C
Entry
YDR097C           CDS       T00005                                 
Symbol
MSH6, PMS3, PMS6
Name
(RefSeq) mismatch repair ATPase MSH6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    YDR097C (MSH6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YDR097C (MSH6)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     YDR097C (MSH6)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_IV MutS_II AAA_27 AAA_29 AAA_23
Other DBs
NCBI-GeneID: 851671
NCBI-ProteinID: NP_010382
SGD: S000002504
UniProt: Q03834
LinkDB
Position
IV:complement(640109..643837)
AA seq 1242 aa
MAPATPKTSKTAHFENGSTSSQKKMKQSSLLSFFSKQVPSGTPSKKVQKPTPATLENTAT
DKITKNPQGGKTGKLFVDVDEDNDLTIAEETVSTVRSDIMHSQEPQSDTMLNSNTTEPKS
TTTDEDLSSSQSRRNHKRRVNYAESDDDDSDTTFTAKRKKGKVVDSESDEDEYLPDKNDG
DEDDDIADDKEDIKGELAEDSGDDDDLISLAETTSKKKFSYNTSHSSSPFTRNISRDNSK
KKSRPNQAPSRSYNPSHSQPSATSKSSKFNKQNEERYQWLVDERDAQRRPKSDPEYDPRT
LYIPSSAWNKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDALLANALFDLKIAGGG
RANMQLAGIPEMSFEYWAAQFIQMGYKVAKVDQRESMLAKEMREGSKGIVKRELQCILTS
GTLTDGDMLHSDLATFCLAIREEPGNFYNETQLDSSTIVQKLNTKIFGAAFIDTATGELQ
MLEFEDDSECTKLDTLMSQVRPMEVVMERNNLSTLANKIVKFNSAPNAIFNEVKAGEEFY
DCDKTYAEIISSEYFSTEEDWPEVLKSYYDTGKKVGFSAFGGLLYYLKWLKLDKNLISMK
NIKEYDFVKSQHSMVLDGITLQNLEIFSNSFDGSDKGTLFKLFNRAITPMGKRMMKKWLM
HPLLRKNDIESRLDSVDSLLQDITLREQLEITFSKLPDLERMLARIHSRTIKVKDFEKVI
TAFETIIELQDSLKNNDLKGDVSKYISSFPEGLVEAVKSWTNAFERQKAINENIIVPQRG
FDIEFDKSMDRIQELEDELMEILMTYRKQFKCSNIQYKDSGKEIYTIEIPISATKNVPSN
WVQMAANKTYKRYYSDEVRALARSMAEAKEIHKTLEEDLKNRLCQKFDAHYNTIWMPTIQ
AISNIDCLLAITRTSEYLGAPSCRPTIVDEVDSKTNTQLNGFLKFKSLRHPCFNLGATTA
KDFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDR
IMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVL
HHVATHIQSLGFFATHYGTLASSFKHHPQVRPLKMSILVDEATRNVTFLYKMLEGQSEGS
FGMHVASMCGISKEIIDNAQIAADNLEHTSRLVKERDLAANNLNGEVVSVPGGLQSDFVR
IAYGDGLKNTKLGSGEGVLNYDWNIKRNVLKSLFSIIDDLQS
NT seq 3729 nt   +upstreamnt  +downstreamnt
atggccccagctacccctaaaacttctaagactgcacacttcgaaaatggctccacatct
tctcaaaagaaaatgaagcaatcgagtttgttatcttttttctcaaaacaggtaccttct
ggcacaccgtcaaagaaggtccagaagcctactccagcgactttagaaaatacagctact
gataagataacaaagaatccacaaggaggaaagacaggcaaacttttcgtagatgtagac
gaagacaatgatttgacaatagctgaagaaacggtatcaactgtaaggagtgacataatg
cattctcaagagccccaatctgatactatgttaaatagtaacacgacagaacctaaaagt
accactacggacgaggatttatcatcttcccaatctcgaaggaatcacaaaaggagagtg
aattatgccgaaagtgatgatgatgactcagatactacattcactgctaaacggaagaag
ggtaaggtagttgatagtgaaagcgatgaggatgaatatttaccagataaaaatgacggc
gatgaagatgacgatattgcagacgacaaagaggacatcaaaggagaattggcagaagat
agtggtgatgacgatgatttaatctctctggcagaaacgacttctaagaaaaaattttca
tacaacacttcgcattcttcatcgccctttacaagaaatatatcccgtgacaactcaaaa
aagaaaagcaggccaaatcaggcaccaagtagatcgtacaatccttctcatagtcaacca
tcagcgacttctaagtctagcaaattcaataaacaaaatgaagaacgatatcaatggtta
gtggatgaacgagatgctcagcgccgtcccaagagtgatccagagtacgatccaagaaca
ctgtacatcccatcttctgcatggaacaagtttactccgtttgaaaaacaatattgggaa
attaaatccaaaatgtgggattgtattgtctttttcaaaaagggtaagttctttgaatta
tatgaaaaggatgcattattggctaatgcattatttgacttaaagattgcaggtggagga
cgcgctaatatgcaactagctgggattccagagatgtcatttgaatattgggccgctcag
tttatccaaatgggatataaagttgcgaaagtggatcaaagagagtcaatgttggctaaa
gaaatgagggaaggttctaaaggtatcgttaaaagagaactccagtgcatattgacatcg
ggtacgttaactgatggagatatgttgcattcggatctggctactttttgtcttgccatc
agggaagaacctggtaacttctacaatgaaactcagctagattcatcaacgatagtgcaa
aagctgaatacaaaaatattcggtgcagcattcattgatactgcaactggtgagcttcaa
atgctggagtttgaagatgatagtgaatgcaccaaattggacacattaatgtcgcaagta
agacctatggaagtcgtcatggagaggaataacttaagcacactagctaacaaaattgta
aaattcaattcagcacccaatgcaatttttaatgaggttaaagccggtgaagaattttat
gactgcgataaaacctatgctgaaatcatatcatcagaatacttttctacggaagaagat
tggccagaggttttgaaatcctattatgatacgggtaaaaaagttggctttagtgcattt
ggtggattattgtattatttgaagtggttaaaactggataagaatttaatttcgatgaaa
aatatcaaagagtacgattttgtaaaatcgcaacactccatggttttagatggtatcact
ttacagaacttggaaatattttccaattcgtttgatggttctgataagggtactttgttc
aaattattcaacagggctattactccaatgggtaagagaatgatgaaaaagtggttaatg
catccattattacgtaagaatgatattgaaagcaggctcgatagtgttgactctttgtta
caagatattacattaagagaacagctagagataacattttcaaaattgccagatttggaa
agaatgttggcccgtatccatagtaggacaattaaagtgaaagattttgaaaaggtaatt
accgcttttgaaacgattattgaattacaagactctttaaagaacaacgatttgaaggga
gatgtttcaaaatacatatcctctttccctgagggacttgtggaagctgtcaaaagctgg
actaatgcttttgaaagacaaaaagcaatcaatgaaaatatcattgtaccacaaagggga
tttgacatagagtttgataagtcaatggatagaatacaggagctagaagacgaattgatg
gaaattctgatgacttataggaagcaattcaaatgttccaatatacaatataaagattcc
ggaaaggagatatacactattgaaattcctatctctgcaactaaaaatgtcccatcaaat
tgggttcaaatggctgcgaacaaaacgtacaagagatactactctgatgaagtaagagct
ttagcaagatcgatggcggaggctaaagaaatacacaagacgttagaggaggacctaaaa
aatagattatgtcaaaaatttgatgcgcattataatacaatttggatgccaaccatacag
gccatctctaacatagattgtttgttggcaattacaaggacatctgaatatctaggtgct
ccctcttgtaggccaaccattgtagatgaggtggactcgaaaacgaatactcaattaaat
ggttttctgaaatttaaatcattaagacatccatgctttaacctcggcgctactacagca
aaggacttcattcctaacgacattgaattaggtaaagaacagcccagattaggattgtta
acgggtgccaacgcagctggtaaatccacgatattgaggatggcatgtattgccgtaatt
atggcacaaatgggatgttatgttccttgtgaatctgccgttctgacgccgattgataga
atcatgactcgtttaggcgctaatgataatatcatgcaaggtaaatctactttttttgtg
gaattggcggaaacaaaaaaaatattagacatggctaccaataggtcattattagttgtt
gacgagttgggaagaggaggttcatcgagtgatggttttgcaattgcagaaagtgtgcta
catcatgtcgcgacacatattcaaagtctgggtttttttgccacacattatgggacattg
gcatcaagtttcaagcaccatcctcaagtaagaccactgaaaatgagcattctagtcgat
gaagcgactaggaacgttacatttttgtataagatgcttgaaggacaaagtgaaggctct
tttggtatgcatgttgcgtcaatgtgtggcatttcaaaggaaattattgataacgcgcag
attgccgctgataatttagaacatacttctaggctagtcaaagaacgtgatttagctgca
aataatttgaatggtgaagttgtctctgtgccaggtggcttacaaagtgatttcgttcga
attgcgtacggagatggactgaagaatacaaaattaggttctggtgaaggggtcttgaac
tatgattggaacataaaaaggaacgttttgaaaagtctatttagtataattgatgattta
caatcctaa

DBGET integrated database retrieval system