KEGG   Saccharomyces cerevisiae (budding yeast): YDR110W
Entry
YDR110W           CDS       T00005                                 
Symbol
FOB1, HRM1
Name
(RefSeq) replication fork barrier binding protein FOB1
  KO
K12577  DNA replication fork-blocking protein FOB1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDR110W (FOB1)
SSDB
Other DBs
NCBI-GeneID: 851688
NCBI-ProteinID: NP_010395
SGD: S000002517
UniProt: O13329
LinkDB
Position
IV:676102..677802
AA seq 566 aa
MTKPRYNDVLFDDDDSVPSESVTRKSQRRKATSPGESRESSKDRLLILPSMGESYTEYVD
SYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKL
LFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFAN
ISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKY
SYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICE
EIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYRFNRRRNK
RTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFALANE
ADNSCNNNGILHNNNIGNDNFEEEVQKQFDLTEKNYIDEYDDLAHDSSEGEFEPNTLTPE
EKPPHNVDEDRIESTGVAAPMQGTEEPEKGDQKESDGASQVDQSVEITRPETSYYQTLES
PSTKRQKLDQQGNGDQTRDFGTSMEL
NT seq 1701 nt   +upstreamnt  +downstreamnt
atgacgaaaccgcgttacaatgacgtgttgtttgatgatgatgactcggtaccatcagaa
tcagttacgaggaaatcgcagagaagaaaggcaacgtcacctggggaatcaagagagtcc
tcaaaagatcgtctactgatacttccctctatgggggaatcatatactgagtacgtagac
tcttatttgaacttagaattattggaaaggggagaaagagaaacaccaatctttcttgaa
tctctgacaagacaactaacgcagaaaatatatgaactaataaaaacaaaatctttaact
gcagataccttgcaacaaataagtgataaatacgatggtgtagtggcagaaaacaagctg
ttatttttgcaaagacagtattatgttgatgatgaaggaaatgttagagatggccgaaat
aatgataaaatatactgtgagccaaagcatgtatacgacatggtgatggcaacacacttg
atgaataagcatcttaggggtaaaacattacattcctttttattttctcattttgccaat
attagtcatgccatcatcgattgggtccagcaattttgttcaaaatgtaataaaaagggc
aaaattaaaccattgaaggaatataaacgtcctgacatgtacgataaactactaccaatg
gaaaggatacatattgaggtattcgaacccttcaatggagaagctattgagggaaaatat
tcttatgtccttttatgccgagactatcgctctagttttatgtggttattaccacttaag
agtaccaaattcaaacatcttatcccagttgtttcctcactttttttaacatttgctagg
gttccaattttcgtaacatcaagcactttagataaagatgatctttatgatatttgtgaa
gaaattgcatcaaaatacggtctccgtattggcttgggtttgaagagttctgcgagattt
catactgggggtatactgtgcattcagtatgctctaaatagttataagaaggaatgtcta
gccgattggggtaagtgcctaagatatggcccttacagattcaaccgaaggagaaataag
agaacgaaacgtaaacctgtgcaagtactacttagtgaagttccaggtcacaatgccaag
tttgagactaagagagaaagggttatagaaaacacatattcccgtaatatgttcaagatg
gcaggtggaaaaggtcttatatatttggaagatgtcaatacttttgcccttgctaatgaa
gcggataatagctgtaacaataatggaattcttcataataacaatataggaaatgataac
tttgaagaagaagtgcaaaaacaatttgatctaactgaaaaaaactatatcgatgagtat
gatgatttggcacatgattcttcagagggcgaatttgaacctaataccttaactcccgaa
gaaaagcctcctcataatgtcgatgaggaccgaatagagtccaccggcgtggcagcccca
atgcagggaacagaagagcctgaaaaaggggatcaaaaagaaagtgacggtgcatcacaa
gtagatcaaagtgtcgaaataactagaccagaaacttcctactatcaaactctggaatcg
ccgtcaacaaaacgacagaaattagaccaacagggtaatggagatcaaacaagagacttt
ggcacatcaatggaattgtaa

DBGET integrated database retrieval system