KEGG   Saccharomyces cerevisiae (budding yeast): YDR260C
Entry
YDR260C           CDS       T00005                                 
Symbol
SWM1, APC13
Name
(RefSeq) Swm1p
  KO
K12416  anaphase-promoting complex subunit SWM1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YDR260C (SWM1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDR260C (SWM1)
   04113 Meiosis - yeast
    YDR260C (SWM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YDR260C (SWM1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YDR260C (SWM1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     YDR260C (SWM1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    YDR260C (SWM1)
SSDB
Motif
Pfam: Apc13p
Other DBs
NCBI-GeneID: 851847
NCBI-ProteinID: NP_010546
SGD: S000002668
UniProt: Q12379
Structure
LinkDB
Position
IV:complement(976717..977229)
AA seq 170 aa
MSSSSYRDSYFQYRHLPAPHHILYAEWNQDILALPDEVANITMAMKDNTRTDAEEGRAPQ
DGERNSNVRESAQGKALMTSEQNSNRYWNSFHDEDDWNLFNGMELESNGVVTFAGQAFDH
SLNGGTNSRNDGANEPRKETITGSIFDRRITQLAYARNNGWHELALPQSR
NT seq 513 nt   +upstreamnt  +downstreamnt
atgagttcaagttcttatagggattcatattttcaataccgccatttaccagcaccacat
cacatattatatgcggaatggaatcaagatatactggcgcttccggacgaagtggcaaat
attacaatggctatgaaagataatactcgcaccgacgcggaggagggaagagctccccaa
gatggggaaaggaattctaatgtacgcgagagcgctcaaggtaaggcattaatgacaagt
gaacaaaatagcaaccgctactggaactcttttcatgatgaagacgattggaatctattc
aatggcatggaactggagagtaatggagtagtgacgtttgctggacaggcgttcgatcat
tctttaaacgggggaaccaattccaggaacgacggtgccaatgagccaagaaaagaaacg
ataactggttctatttttgataggcgcatcacacaattggcgtacgcaagaaataacggt
tggcacgaactggctctcccacagtcacgatga

DBGET integrated database retrieval system