KEGG   Saccharomyces cerevisiae (budding yeast): YDR311W
Entry
YDR311W           CDS       T00005                                 
Symbol
TFB1
Name
(RefSeq) TFIIH/NER complex subunit TFB1
  KO
K03141  transcription initiation factor TFIIH subunit 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03022  Basal transcription factors
sce03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    YDR311W (TFB1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    YDR311W (TFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YDR311W (TFB1)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YDR311W (TFB1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     YDR311W (TFB1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     YDR311W (TFB1)
SSDB
Motif
Pfam: BSD PH_TFIIH
Other DBs
NCBI-GeneID: 851906
NCBI-ProteinID: NP_010597
SGD: S000002719
UniProt: P32776
Structure
LinkDB
Position
IV:1085065..1086993
AA seq 642 aa
MSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMML
RLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDADIYEEK
RRREESAQHTETPMSSSSVTAGTPTPHLDTPQLNNGAPLINTAKLDDSLSKEKLLTNLKL
QQSLLKGNKVLMKVFQETVINAGLPPSEFWSTRIPLLRAFALSTSQKVGPYNVLSTIKPV
ASSENKVNVNLSREKILNIFENYPIVKKAYTDNVPKNFKEPEFWARFFSSKLFRKLRGEK
IMQNDRGDVIIDRYLTLDQEFDRKDDDMLLHPVKKIIDLDGNIQDDPVVRGNRPDFTMQP
GVDINGNSDGTVDILKGMNRLSEKMIMALKNEYSRTNLQNKSNITNDEEDEDNDERNELK
IDDLNESYKTNYAIIHLKRNAHEKTTDNDAKSSADSIKNADLKVSNQQMLQQLSLVMDNL
INKLDLNQVVPNNEVSNKINKRVITAIKINAKQAKHNNVNSALGSFVDNTSQANELEVKS
TLPIDLLESCRMLHTTCCEFLKHFYIHFQSGEQKQASTVKKLYNHLKDCIEKLNELFQDV
LNGDGESMSNTCTAYLKPVLNSITLATHKYDEYFNEYNNNSN
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgtcacattccggagctgccatttttgagaaagtttctgggataattgccataaatgag
gatgtttcacccgcagaattgacatggaggtctacggacggtgacaaggttcacacagtt
gtcttatccactattgacaagttacaagctacccctgcttccagtgaaaaaatgatgttg
aggctaatcgggaaagtggatgagtcaaaaaagagaaaagacaacgaaggaaatgaggtt
gtgcccaaaccgcaacgtcatatgttttcgtttaacaatagaacagttatggataatatc
aagatgacccttcaacaaatcatctcacggtataaagatgcagatatctacgaagaaaag
agaagaagagaggagtctgcgcaacacacagaaacaccaatgagctcttcttctgttact
gcagggactcccacaccacatctcgatacaccacaattgaataatggggctccgttgatt
aatacagccaaactagatgattctctctctaaagaaaaattgttgaccaatttaaagcta
cagcaatctttactgaaaggaaacaaagttctaatgaaggtttttcaggaaacagtcatt
aacgccggtttgcctccatctgaattttggtcaactagaattccgttattgagggctttt
gccttatctacttctcaaaaagttgggccttacaacgttttgtcaactatcaagccggtg
gcttcatcggaaaacaaagtcaatgttaatttgtcaagagaaaaaattttgaatattttt
gagaactatccaattgtaaagaaagcttacactgataatgtgcccaaaaatttcaaagaa
ccagagttctgggcaaggttcttctcttcgaagttattcagaaaattaaggggtgaaaag
atcatgcaaaatgatagaggtgacgtaatcattgacaggtacttgacattggatcaagag
ttcgacagaaaagatgatgacatgctattgcatcctgtgaaaaaaattatagatttagat
ggtaacatacaggacgacccagttgtacgaggcaacaggcccgacttcactatgcagcca
ggtgtggatattaatggtaatagcgatggtaccgtggacatcttaaagggtatgaataga
ttgagtgaaaaaatgattatggctttgaagaatgagtattcaaggacaaatctacagaac
aaatctaatattacaaacgatgaggaagatgaagataatgatgaaagaaatgaactgaaa
atcgatgacttaaacgaaagctacaagacaaactatgcaatcatacatctgaaaaggaac
gcacatgaaaagacaaccgacaacgatgcgaaaagctcggcagactcgataaagaatgca
gatttgaaggtttctaatcaacaaatgttacaacagttgtcattggtcatggataattta
attaataagctagacttgaaccaagtagttcctaacaacgaagtcagcaacaagatcaat
aaaagagtcataactgcaatcaagattaacgccaaacaggctaagcataacaatgttaat
tcagcactcggctcttttgtcgacaacacttctcaagcaaatgaattagaggtgaaaagt
accctaccaatagacctattagaaagttgtagaatgctacacacaacgtgctgtgaattt
ctaaagcacttttatattcattttcagagcggtgaacaaaagcaagccagtaccgtcaaa
aaactttataatcatttgaaggactgtattgaaaagctgaatgagctatttcaagacgtc
cttaatggtgatggtgaatctatgtcaaacacatgtaccgcctatttgaagccagttttg
aactccattactttggctactcataagtacgatgagtacttcaacgaatataacaacaat
tcgaactag

DBGET integrated database retrieval system