KEGG   Saccharomyces cerevisiae (budding yeast): YDR328C
Entry
YDR328C           CDS       T00005                                 
Symbol
SKP1, MGO1
Name
(RefSeq) SCF ubiquitin ligase subunit SKP1
  KO
K03094  S-phase kinase-associated protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04120  Ubiquitin mediated proteolysis
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YDR328C (SKP1)
   04120 Ubiquitin mediated proteolysis
    YDR328C (SKP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YDR328C (SKP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YDR328C (SKP1)
   04121 Ubiquitin system [BR:sce04121]
    YDR328C (SKP1)
   03036 Chromosome and associated proteins [BR:sce03036]
    YDR328C (SKP1)
Membrane trafficking [BR:sce04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    YDR328C (SKP1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     YDR328C (SKP1)
   Cul7 complex
     YDR328C (SKP1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     YDR328C (SKP1)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     YDR328C (SKP1)
SSDB
Motif
Pfam: Skp1 Skp1_POZ rRNA_processing
Other DBs
NCBI-GeneID: 851928
NCBI-ProteinID: NP_010615
SGD: S000002736
UniProt: P52286
Structure
LinkDB
Position
IV:complement(1125434..1126018)
AA seq 194 aa
MVTSNVVLVSGEGERFTVDKKIAERSLLLKNYLNDMHDSNLQNNSDSESDSDSETNHKSK
DNNNGDDDDEDDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDSWD
REFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTPEE
EAAIRRENEWAEDR
NT seq 585 nt   +upstreamnt  +downstreamnt
atggtgacttctaatgttgtcctagtgagtggtgagggtgaacgattcaccgtagacaag
aaaatcgcggagagatccctgctattgaaaaactatctgaacgatatgcatgacagcaac
ctacaaaacaactcagattcagaatcagattcagactcggaaacgaaccacaaaagcaaa
gacaacaataacggtgacgacgacgatgaggatgacgacgagattgtgatgcccgtgccc
aatgttcggtcttccgttttgcagaaggttatcgaatgggccgagcaccacagagactct
aacttccctgacgaagatgacgacgattccagaaagagtgctcccgtggactcatgggac
agagaattcctgaaagtggaccaagagatgctatacgaaattattctggcggcaaactac
ctcaacatcaagcccttgcttgacgctggctgcaaggtggttgctgaaatgatcagggga
aggtctcccgaggaaattagaagaacgtttaatatcgtcaacgacttcactccagaggag
gaggctgccattaggcgtgaaaatgaatgggctgaagaccgttag

DBGET integrated database retrieval system