KEGG   Saccharomyces cerevisiae (budding yeast): YDR386W
Entry
YDR386W           CDS       T00005                                 
Symbol
MUS81, SLX3
Name
(RefSeq) Mus81p
  KO
K08991  crossover junction endonuclease MUS81 [EC:3.1.22.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YDR386W (MUS81)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YDR386W (MUS81)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.-
     YDR386W (MUS81)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     YDR386W (MUS81)
SSDB
Motif
Pfam: ERCC4 PBC
Other DBs
NCBI-GeneID: 851994
NCBI-ProteinID: NP_010674
SGD: S000002794
UniProt: Q04149
LinkDB
Position
IV:1246084..1247982
AA seq 632 aa
MELSSNLKDLYIEWLQELVDGLTPKQEQLKIAYEKAKRNLQNAEGSFYYPTDLKKVKGIG
NTIIKRLDTKLRNYCKIHHISPVEAPSLTQTSSTRPPKRTTTALRSIVNSCENDKNEAPE
EKGTKKRKTRKYIPKKRSGGYAILLSLLELNAIPRGVSKEQIIEVAGKYSDHCMTPNFST
KEFYGAWSSIAALKKHSLVLEEGRPKRYSLTEEGVELTKSLKTADGISFPKENEEPNEYS
VTRNESSEFTANLTDLRGEYGKEEEPCDINNTSFMLDITFQDLSTPQRLQNNVFKNDRLN
SQTNISSHKLEEVSDDQTVPDSALKAKSTIKRRRYNGVSYELWCSGDFEVFPIIDHREIK
SQSDREFFSRAFERKGMKSEIRQLALGDIIWVAKNKNTGLQCVLNTIVERKRLDDLALSI
RDNRFMEQKNRLEKSGCEHKYYLIEETMSGNIGNMNEALKTALWVILVYYKFSMIRTCNS
DETVEKIHALHTVISHHYSQKDLIVIFPSDLKSKDDYKKVLLQFRREFERKGGIECCHNL
ECFQELMGKGDLKTVGELTIHVLMLVKGISLEKAVAIQEIFPTLNKILMAYKTCSSEEEA
KLLMFNVLGDAPGAKKITKSLSEKIYDAFGKL
NT seq 1899 nt   +upstreamnt  +downstreamnt
atggaactctcatcaaacttaaaagacctatatattgaatggttacaagaattagttgac
ggattaacccctaaacaagaacaactcaaaatagcctatgaaaaagcaaaaaggaattta
caaaatgctgaaggttcattttattatcctacagatctaaagaaagttaagggaattggc
aatacaataataaagagattagatacgaaattacggaactattgcaaaattcaccacata
tctcccgttgaggctccttccttaactcagacaagtagcaccagaccaccaaagaggact
actacagctttgcgtagcatagtaaactcatgcgaaaatgataagaatgaagctcccgaa
gagaagggaactaaaaagagaaaaactaggaagtatatacccaaaaaaagatctggaggc
tacgctatccttctttccttactcgagcttaatgccattcctcgaggcgttagtaaagag
caaatcatcgaggttgcaggaaaatacagtgaccattgtatgactccaaatttctccaca
aaagaattctacggtgcttggtcgtctattgctgcacttaaaaaacattcgttggttctt
gaggaaggtagaccaaaacggtattcgctaacagaggaaggtgtagaactaacaaagagc
ttaaagacggcagacggaatctcttttccaaaagaaaatgaagaacctaacgagtattcc
gtaaccaggaatgaaagtagtgaattcacagcaaatctgactgacctccgtggtgaatat
ggtaaggaagaagagccctgcgatataaataacacttcattcatgctggatataactttt
caagatttgagcacgccgcaaaggctgcagaacaatgtatttaaaaatgatagactgaat
agccaaactaatatatcttctcataaattggaagaggtctctgatgatcaaacagtacct
gattccgcattaaaggctaaaagcacaataaagaggagaaggtacaacggagtaagttac
gaattgtggtgtagtggtgatttcgaagttttcccaattattgatcacagagaaataaag
tcacaatctgatcgtgagtttttttcaagggcatttgaaagaaaaggtatgaagtcagag
ataaggcaactcgctttgggtgatattatatgggttgccaagaataaaaataccgggttg
cagtgtgtgctcaacaccatagttgaaagaaaaaggctagacgatttagctttaagtata
agggataacaggtttatggagcaaaaaaataggttagagaaatctggctgtgaacacaaa
tactatctcattgaggagactatgagtggcaacattggaaatatgaatgaggccctaaag
accgcgctttgggtcattttagtgtattacaaattctccatgataagaacttgcaattcg
gatgaaactgtggaaaagatacatgcgttgcatactgtaatttctcatcactattctcaa
aaagatctcatagttatatttccaagtgaccttaaaagcaaggacgattataaaaaggtg
cttctacagtttcgtcgagaattcgaacgaaaaggcggtattgaatgctgtcataatctt
gaatgctttcaagaactaatgggaaaaggcgatctaaagacggttggtgagctaactata
catgttttaatgcttgttaaaggtatatctttagaaaaagcagtagccatccaagaaata
tttcctaccctgaataaaatactaatggcatataaaacgtgctcctcggaagaagaggct
aaattgttgatgtttaatgtactgggagatgcacctggtgcgaagaaaattactaaatct
ctttcagaaaagatatatgatgcttttggtaaactttag

DBGET integrated database retrieval system