KEGG   Saccharomyces cerevisiae (budding yeast): YDR409W
Entry
YDR409W           CDS       T00005                                 
Symbol
SIZ1, ULL1
Name
(RefSeq) SUMO ligase SIZ1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YDR409W (SIZ1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YDR409W (SIZ1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sce04812]
    YDR409W (SIZ1)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-
     YDR409W (SIZ1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   YDR409W (SIZ1)
Cytoskeleton proteins [BR:sce04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    YDR409W (SIZ1)
SSDB
Motif
Pfam: PINIT zf-MIZ SAP SAP_new25 zf-Nse zf-RING_UBOX zf-C3HC4_2
Other DBs
NCBI-GeneID: 852018
NCBI-ProteinID: NP_010697
SGD: S000002817
UniProt: Q04195
Structure
LinkDB
Position
IV:1289406..1292120
AA seq 904 aa
MINLEDYWEDETPGPDREPTNELRNEVEETITLMELLKVSELKDICRSVSFPVSGRKAVL
QDLIRNFLQNALVVGKSDPYRVQAVKFLIERIRKNEPLPVYKDLWNALRKGTPLSAITVR
SMEGPPTVQQQSPSVIRQSPTQRRKTSTTSSTSRAPPPTNPDASSSSSSFAVPTIHFKES
PFYKIQRLIPELVMNVEVTGGRGMCSAKFKLSKADYNLLSNPNSKHRLYLFSGMINPLGS
RGNEPIQFPFPNELRCNNVQIKDNIRGFKSKPGTAKPADLTPHLKPYTQQNNVELIYAFT
TKEYKLFGYIVEMITPEQLLEKVLQHPKIIKQATLLYLKKTLREDEEMGLTTTSTIMSLQ
CPISYTRMKYPSKSINCKHLQCFDALWFLHSQLQIPTWQCPVCQIDIALENLAISEFVDD
ILQNCQKNVEQVELTSDGKWTAILEDDDDSDSDSNDGSRSPEKGTSVSDHHCSSSHPSEP
IIINLDSDDDEPNGNNPHVTNNHDDSNRHSNDNNNNSIKNNDSHNKNNNNNNNNNNNNND
NNNSIENNDSNSNNKHDHGSRSNTPSHNHTKNLMNDNDDDDDDRLMAEITSNHLKSTNTD
ILTEKGSSAPSRTLDPKSYNIVASETTTPVTNRVIPEYLGNSSSYIGKQLPNILGKTPLN
VTAVDNSSHLISPDVSVSSPTPRNTASNASSSALSTPPLIRMSSLDPRGSTVPDKTIRPP
INSNSYTASISDSFVQPQESSVFPPREQNMDMSFPSTVNSRFNDPRLNTTRFPDSTLRGA
TILSNNGLDQRNNSLPTTEAITRNDVGRQNSTPVLPTLPQNVPIRTNSNKSGLPLINNEN
SVPNPPNTATIPLQKSRLIVNPFIPRRPYSNVLPQKRQLSNTSSTSPIMGTWKTQDYGKK
YNSG
NT seq 2715 nt   +upstreamnt  +downstreamnt
atgataaatttagaggattactgggaagatgaaacgcctgggcctgatagggaaccgact
aatgaactaagaaacgaggtggaggaaaccatcactctgatggaactgctgaaagtgtcc
gaattgaaggatatttgcaggtctgtatctttcccggtttccggtcgcaaggccgttcta
caggaccttatcaggaatttcttgcagaacgctttagtagtaggcaagtctgatccttat
agagttcaagccgttaaatttctgatagaacggatcagaaagaatgaacctttgcctgtt
tataaagatctttggaacgctttaagaaagggtaccccattgagtgctatcacagtacgt
tctatggaggggcctcccacggtgcagcagcaatcaccttccgttattaggcagtctccc
actcaacggcggaaaacgtctaccacatcttccacatctcgtgcaccaccacctacaaat
ccagatgcctcttcttcttcatcatcttttgctgtaccgacaattcattttaaagagtct
ccattttacaaaatacaaaggctaatccctgaattagtgatgaacgtggaagtcacaggc
ggaagaggtatgtgctctgcgaaatttaaattgtccaaagcagactataatctattaagt
aacccgaatagcaaacacaggctatacttattttctgggatgattaatccattaggatcc
cgaggtaatgaacccatccaatttccattcccaaatgaattaaggtgcaataatgttcaa
atcaaagataatataagaggtttcaagagtaagccgggcacagctaagccggcggattta
acgcctcatctcaaaccttatactcaacaaaacaatgtggagctgatatatgccttcacc
acgaaggaatacaagctatttgggtacattgtagaaatgatcactccggagcaactcctg
gaaaaagtattacagcatccaaaaattattaaacaagccacgttactttacttgaaaaaa
acacttcgggaggatgaagaaatgggcttgactaccacatctactatcatgagtctgcaa
tgtccaatttcgtacacaagaatgaaatacccttcaaaatcaataaattgtaagcatctg
caatgttttgatgcattatggttcctacactcccaactacaaattcctacgtggcaatgc
ccagtatgtcaaattgatatagctttggaaaatttagcaatttccgaatttgttgatgac
attttacagaactgtcaaaaaaacgttgaacaggtagaacttacttctgatggtaagtgg
acagccatattggaagacgatgatgacagcgacagtgacagcaatgatggtagtagaagc
ccagaaaaaggtacttcagtatcggatcatcattgttcttcttcacatccaagtgaaccg
attatcataaatctcgatagtgatgatgacgaaccaaatggaaataatcctcatgttact
aataatcatgatgatagcaacaggcatagtaatgataacaataataatagtatcaaaaat
aatgatagtcataataaaaataataataataataataataacaataataataataatgat
aataataatagtatcgaaaataatgatagtaatagtaataataaacatgatcatggtagt
cgcagtaatactcccagtcataatcatactaaaaatttaatgaacgataatgatgacgat
gatgatgatcgacttatggcggaaataactagcaatcaccttaaaagtactaatacagat
attctaactgaaaaaggttcaagtgcaccctcgagaaccctggatccaaaaagttataac
atagttgcttcagaaactactactccggtgacaaacagggttattcctgagtacctcgga
aacagttccagttatattggtaaacaattgccgaacattctgggaaaaacgcctttaaat
gtgactgctgttgataattcatcccacttaatctctccagatgttagcgtatcatcccca
acgccaagaaacaccgcttcaaatgcaagttcgagcgctctcagtacccctcccttaata
agaatgagttcattagatcccaggggatccactgttcccgataaaacaataaggcctccc
ataaattccaacagttatactgcatcgatatcagattcatttgtccagcctcaagaatct
tcagtttttccaccacgtgaacagaatatggatatgtcctttccttccaccgtgaactca
agatttaatgatccacgtttgaataccacaagattccctgattcaacattgcgtggggca
actattttgtcgaataatgggcttgatcaaaggaataactctctaccaacaacagaagca
atcacgaggaatgacgtcgggcgacaaaattctacgcctgtacttcccacgttgccccag
aacgtcccaattcgtacaaactctaacaagtctgggcttcctttgataaacaatgaaaac
agtgtccccaatcctcccaacactgcaaccataccgttgcagaagtccagactcattgta
aatccattcattccaaggaggccttactctaatgtactgccccaaaaaagacaactttct
aatacatcctcaacttcacccataatgggtacatggaaaacgcaagattatggaaagaaa
tacaacagtggttaa

DBGET integrated database retrieval system