KEGG   Saccharomyces cerevisiae (budding yeast): YDR460W
Entry
YDR460W           CDS       T00005                                 
Symbol
TFB3, RIG2
Name
(RefSeq) TFIIH/NER complex subunit TFB3
  KO
K10842  CDK-activating kinase assembly factor MAT1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03022  Basal transcription factors
sce03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    YDR460W (TFB3)
  09124 Replication and repair
   03420 Nucleotide excision repair
    YDR460W (TFB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YDR460W (TFB3)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YDR460W (TFB3)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     YDR460W (TFB3)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     YDR460W (TFB3)
SSDB
Motif
Pfam: MAT1 zf-C3HC4_5 zf-C3HC4_2 zf-RING_2 zf-C3HC4_3 Perilipin zf-C3HC4 zf-RING_UBOX zf-RING_16 Exonuc_VII_L FliS Mitovir_RNA_pol
Other DBs
NCBI-GeneID: 852071
NCBI-ProteinID: NP_010748
SGD: S000002868
UniProt: Q03290
Structure
LinkDB
Position
IV:1383811..1384776
AA seq 321 aa
MLMDEYEENKDMCPICKTDRYLSPDVKFLVNPECYHRICESCVDRIFSLGPAQCPYKGCD
KILRKNKFKTQIFDDVEVEKEVDIRKRVFNVFNKTIDDFNGDLVEYNKYLEEVEDIIYKL
DHGIDVAKTEEKLRTYEELNKQLIMNNLERSRTEIESFEQRQKFEKEMKLKKRLLERQIE
EEERMNKEWTKKEIVNRLSTTTQDINETIEGVKNTVKLKKSSARRKLEELNRVLKNNPYF
NSNVNVQNSRLKDAVPFTPFNGDREAHPRFTLKGSVYNDPFIKDLEHRKEFIASGFNTNY
AYERVLTEAFMGLGCVISEEL
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcttatggatgagtatgaggaaaacaaggacatgtgtccgatctgtaagacagatcga
tacctttctccggatgtgaaatttttggtgaatcctgaatgctatcacaggatctgtgag
tcgtgtgttgatcgaatatttagtctcggtcctgcccagtgtccatataaagggtgtgac
aagattcttagaaagaataagttcaagacccaaatattcgatgatgtggaagttgagaaa
gaagttgacatcaggaagagagtgttcaatgtgttcaacaaaactatcgatgacttcaat
ggtgaccttgtggaatataacaaatatttggaagaggtggaagacattatatacaaacta
gatcacgggatcgatgtggctaagaccgaggagaaactacgcacctacgaggaattaaac
aagcaactgattatgaataacttggagagaagcagaacagagatagaaagtttcgaacag
agacaaaaattcgaaaaggagatgaaattgaagaagcgactgttggaaagacaaatcgaa
gaggaggaaagaatgaacaaagagtggacaaagaaagaaatcgtcaaccggttgagtacg
accacccaggatatcaatgaaacaatcgaaggcgttaaaaatacggttaaattgaaaaaa
tcgtccgctagaaggaaattggaagaactaaatagagttctgaaaaacaatccatatttc
aattcaaatgtgaacgtacagaattcgagactcaaagatgctgtaccgttcacgccgttt
aacggtgatagagaagcacacccaaggtttacgttgaaaggttcagtatacaatgaccca
ttcatcaaagatcttgagcacaggaaagaatttattgcgtctgggttcaacactaattat
gcgtacgaaagggtgttgacagaggcatttatgggcttaggatgtgttatatccgaggag
ctttaa

DBGET integrated database retrieval system