KEGG   Saccharomyces cerevisiae (budding yeast): YEL032W
Entry
YEL032W           CDS       T00005                                 
Symbol
MCM3
Name
(RefSeq) MCM DNA helicase complex subunit MCM3
  KO
K02541  DNA replication licensing factor MCM3 [EC:5.6.2.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YEL032W (MCM3)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YEL032W (MCM3)
   04113 Meiosis - yeast
    YEL032W (MCM3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YEL032W (MCM3)
   03036 Chromosome and associated proteins [BR:sce03036]
    YEL032W (MCM3)
Enzymes [BR:sce01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     YEL032W (MCM3)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YEL032W (MCM3)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    YEL032W (MCM3)
SSDB
Motif
Pfam: MCM MCM_OB MCM_lid Mg_chelatase MCM_N ORC6 AAA_3 Sigma54_activat AAA_5 Ndc1_Nup
Other DBs
NCBI-GeneID: 856680
NCBI-ProteinID: NP_010882
SGD: S000000758
UniProt: P24279
Structure
LinkDB
Position
V:86937..89852
AA seq 971 aa
MEGSTGFDGDATTFFAPDAVFGDRVRRFQEFLDTFTSYRDSVRSIQVYNSNNAANYNDDQ
DDADERDLLGDDDGDDLEKEKKAASSTSLNILPHRIIISLDDLREFDRSFWSGILVEPAY
FIPPAEKALTDLADSMDDVPHPNASAVSSRHPWKLSFKGSFGAHALSPRTLTAQHLNKLV
SVEGIVTKTSLVRPKLIRSVHYAAKTGRFHYRDYTDATTTLTTRIPTPAIYPTEDTEGNK
LTTEYGYSTFIDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKPGDRVNVVGVFKS
LGAGGMNQSNSNTLIGFKTLILGNTVYPLHARSTGVAARQMLTDFDIRNINKLSKKKDIF
DILSQSLAPSIYGHDHIKKAILLMLMGGVEKNLENGSHLRGDINILMVGDPSTAKSQLLR
FVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGVVCIDEFDKMTD
VDRVAIHEVMEQQTVTIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPHQNIALPDSLL
SRFDLLFVVTDDINEIRDRSISEHVLRTHRYLPPGYLEGEPVRERLNLSLAVGEDADINP
EEHSNSGAGVENEGEDDEDHVFEKFNPLLQAGAKLAKNKGNYNGTEIPKLVTIPFLRKYV
QYAKERVIPQLTQEAINVIVKNYTDLRNDDNTKKSPITARTLETLIRLATAHAKVRLSKT
VNKVDAKVAANLLRFALLGEDIGNDIDEEESEYEEALSKRSPQKSPKKRQRVRQPASNSG
SPIKSTPRRSTASSVNATPSSARRILRFQDDEQNAGEDDNDIMSPLPADEEAELQRRLQL
GLRVSPRRREHLHAPEEGSSGPLTEVGTPRLPNVSSAGQDDEQQQSVISFDNVEPGTIST
GRLSLISGIIARLMQTEIFEEESYPVASLFERINEELPEEEKFSAQEYLAGLKIMSDRNN
LMVADDKVWRV
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggaaggctcaacgggatttgatggagacgctactacttttttcgctccagacgctgtg
tttggtgacagagtgcgcagatttcaagagtttttagatactttcacctcatacagagac
tctgtaaggtccatacaagtttacaacagcaataacgcggccaactacaacgatgatcaa
gatgacgcagacgaacgagatttgctaggtgatgacgacggtgatgatcttgaaaaggaa
aagaaagcagcatcgtccacctcattgaatatactccctcacaggattatcatctcgctt
gatgacttgagagaattcgacaggtcgttctggtcgggcattttagtcgaaccagcatac
ttcatcccgcctgccgaaaaggcgcttactgacctagcagattccatggacgatgttcca
catcccaatgcctctgcagtatcgtctcgccatccttggaagctttcgttcaaaggctca
tttggtgcacacgcattgtctcctcgtactctaacggcacaacatttaaacaaactggtc
tctgttgagggtatcgtaactaagacttcgttggtcaggccaaagcttatcagatctgtc
cactacgcggcaaagactggtagattccattacagagattatacagatgctactacaact
ctcaccacccgcatcccaacgcctgccatctatccaacggaggacactgaaggtaacaaa
ctaaccaccgaatatgggtatagtacgttcatagaccatcagcgtatcactgtgcaagaa
atgcccgaaatggcccccgctggccaacttcccaggtccattgacgtcattctcgatgac
gaccttgtggacaagaccaagccaggtgacagagttaacgttgtcggggtattcaagtcg
cttggtgctggtggcatgaaccagtccaactctaatacattgatcgggttcaaaactctg
atcctaggtaatacggtgtatcctctccacgccagatccacgggtgtcgctgcgagacaa
atgttgacagatttcgatataagaaatatcaataaactatccaaaaaaaaggacattttc
gatatcttgtctcaatctttagcgccttctatttatggacatgaccatataaagaaagcc
attttattgatgctcatgggaggtgtggagaaaaatttagaaaatggctcgcatttaaga
ggtgacatcaatatcctaatggtgggtgatccatccactgccaagtcccaattgctaagg
tttgtgttgaatacagcatcactggcaattgctactactggtagaggttcttccggtgtc
ggtttgaccgcagcggtcactactgatagggaaacaggtgaaagaagactagaggctggt
gccatggttcttgctgaccgcggggttgtatgtattgatgaatttgataagatgacagat
gtggatagagtcgccattcatgaagtaatggaacaacaaacggtgacgattgccaaagca
ggtattcacacaacattaaatgctcgttgtagtgttattgctgccgcaaatcccgttttt
gggcagtacgatgtcaatagagatccacaccaaaacattgccctaccggactcgctgttg
tctcgttttgatttactatttgttgtgacagacgatatcaatgaaatcagagatagatcc
attagtgagcatgtcttaagaacacacagatatttgcctccaggttatttagagggtgaa
cctgtgagagagcgtttgaatttatcattagccgttggggaggatgcagatataaatcct
gaagagcattccaactccggggctggtgtagaaaatgaaggagaagatgatgaagaccat
gtcttcgaaaagttcaaccccttattacaagcaggtgctaagttagcaaaaaacaaaggt
aactataacggtacagaaattccaaagctagtcaccatcccattcttaagaaagtacgtt
caatatgccaaggaaagggttattccacagttaacacaagaagccatcaatgttattgtg
aaaaattatactgatttaagaaacgatgataataccaaaaaatcgcccattactgcaaga
actttggagactttgatcagattagccacagctcacgccaaagtcaggttatccaaaaca
gtcaacaaggtggatgctaaagtggctgccaatctactaaggtttgcactattgggtgag
gatatcggcaatgatatcgatgaagaggaaagtgaatacgaagaagctttgtcgaagagg
tctccacagaaatcaccgaaaaaaagacaaagagtcagacaaccagcaagcaactctgga
tccccaatcaaatctactccaagaaggtcaacggcatcttccgttaatgccacgccatcg
tcagcacgcagaatattacgttttcaagatgacgaacagaacgctggtgaagacgataac
gatataatgtcaccgcttcctgcggatgaggaagctgaattacaaagaaggcttcaactg
gggttgagagtgtctccaagacgtagagaacatcttcacgcacctgaggaaggttcgtcg
ggacctcttaccgaggtcggtactccaagattacctaacgtatcttctgcaggtcaggat
gatgagcaacaacagtcagttatttcttttgacaatgtggagcctggtaccatttctact
ggtagattgtctttaatctcaggtattattgcgcgtctgatgcaaacagaaatatttgaa
gaagaatcctatcctgtggcctctttgttcgaaagaatcaacgaagaactaccggaggag
gaaaaattctccgctcaagaatatttagcaggtttgaagatcatgtcggacagaaataac
ttaatggttgctgacgataaagtttggagagtctga

DBGET integrated database retrieval system