KEGG   Saccharomyces cerevisiae (budding yeast): YER171W
Entry
YER171W           CDS       T00005                                 
Symbol
RAD3, REM1
Name
(RefSeq) TFIIH/NER complex ATP-dependent 5'-3' DNA helicase subunit RAD3
  KO
K10844  DNA excision repair protein ERCC-2 [EC:5.6.2.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03022  Basal transcription factors
sce03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    YER171W (RAD3)
  09124 Replication and repair
   03420 Nucleotide excision repair
    YER171W (RAD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YER171W (RAD3)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YER171W (RAD3)
Enzymes [BR:sce01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     YER171W (RAD3)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     YER171W (RAD3)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     YER171W (RAD3)
SSDB
Motif
Pfam: DEAD_2 HBB Helicase_C_2 ResIII DUF5667
Other DBs
NCBI-GeneID: 856918
NCBI-ProteinID: NP_011098
SGD: S000000973
UniProt: P06839
Structure
LinkDB
Position
V:527082..529418
AA seq 778 aa
MKFYIDDLPVLFPYPKIYPEQYNYMCDIKKTLDVGGNSILEMPSGTGKTVSLLSLTIAYQ
MHYPEHRKIIYCSRTMSEIEKALVELENLMDYRTKELGYQEDFRGLGLTSRKNLCLHPEV
SKERKGTVVDEKCRRMTNGQAKRKLEEDPEANVELCEYHENLYNIEVEDYLPKGVFSFEK
LLKYCEEKTLCPYFIVRRMISLCNIIIYSYHYLLDPKIAERVSNEVSKDSIVIFDEAHNI
DNVCIESLSLDLTTDALRRATRGANALDERISEVRKVDSQKLQDEYEKLVQGLHSADILT
DQEEPFVETPVLPQDLLTEAIPGNIRRAEHFVSFLKRLIEYLKTRMKVLHVISETPKSFL
QHLKQLTFIERKPLRFCSERLSLLVRTLEVTEVEDFTALKDIATFATLISTYEEGFLLII
EPYEIENAAVPNPIMRFTCLDASIAIKPVFERFSSVIITSGTISPLDMYPRMLNFKTVLQ
KSYAMTLAKKSFLPMIITKGSDQVAISSRFEIRNDPSIVRNYGSMLVEFAKITPDGMVVF
FPSYLYMESIVSMWQTMGILDEVWKHKLILVETPDAQETSLALETYRKACSNGRGAILLS
VARGKVSEGIDFDHQYGRTVLMIGIPFQYTESRILKARLEFMRENYRIRENDFLSFDAMR
HAAQCLGRVLRGKDDYGVMVLADRRFSRKRSQLPKWIAQGLSDADLNLSTDMAISNTKQF
LRTMAQPTDPKDQEGVSVWSYEDLIKHQNSRKDQGGFIENENKEGEQDEDEDEDIEMQ
NT seq 2337 nt   +upstreamnt  +downstreamnt
atgaagttttatatagatgatttaccagtgctttttccataccccaagatatatccagag
cagtataattatatgtgcgatattaaaaagactctggatgtaggtggaaatagtatcttg
gagatgccttcaggaacaggtaaaacggtctcattactatccctcacaattgcctaccag
atgcactacccagaacatagaaagatcatatattgttctcgtactatgtctgaaattgaa
aaagctttagtagagttagagaaccttatggattacagaactaaagaactaggctatcaa
gaggattttcgaggtcttggcttgacatcaagaaaaaatttgtgtttgcatcccgaagtg
agtaaggaacgaaaaggtacagtagtcgatgaaaagtgccgtagaatgacaaatgggcag
gcgaagagaaaattagaagaggatccagaggcaaatgtagaattgtgtgaataccatgag
aatttgtacaatattgaagtagaggattatcttccaaaaggcgtattttcttttgaaaaa
cttttgaaatactgcgaagaaaaaacactttgtccatattttattgttcgtcgtatgatt
tctctttgtaacattattatttattcttaccattatctattagatcctaaaattgctgaa
agagtttccaacgaggtttctaaagatagcattgtcatttttgatgaagcgcacaatatt
gataatgtgtgtatcgaatcgctgtcattagacttgacaacggatgcattgagaagagcc
acacgaggtgctaatgcgttagatgaacgtatttctgaggtcagaaaggttgactcacag
aaattacaggatgaatacgaaaaactagttcaaggtctccattctgcagatattcttacc
gaccaggaagagccatttgtggaaacacctgtattgccccaagatcttctaacagaagca
atcccgggaaatatacgaagagccgagcattttgtttcatttttgaaaagattgatagaa
tatctgaagaccagaatgaaagttcttcacgttatttcagaaacgccaaaatcatttcta
cagcatttaaaacagttaactttcatagaaaggaaacctcttcggttttgctcagaaagg
ctatcattacttgtaagaactttagaagttacagaggtagaagattttactgcattgaaa
gacatagcaacttttgctactcttatatcaacatatgaggaagggtttttactaattatt
gaaccgtatgaaatcgaaaatgctgcagttccgaatccgattatgagatttacttgctta
gatgcatcgattgccatcaaaccagtctttgagagattttcttccgttattatcacttca
gggaccatatcaccattagacatgtatccaagaatgttaaactttaaaactgttttacaa
aaatcatatgccatgaccttagccaaaaaatcatttctaccaatgattattaccaagggt
tctgatcaagttgcaatttcttcaagatttgaaatcagaaacgatcctagtattgttcgt
aattacggttctatgctagtagagtttgccaagatcacacctgatggaatggttgttttt
ttcccctcatatctatatatggaaagtattgtttcaatgtggcaaacaatgggtattctt
gacgaagtttggaaacataaattaattttagttgagactcctgatgctcaagaaacttct
ttagccttagaaacctatagaaaggcttgctcaaatgggcgtggggcaattttgctttct
gttgctagaggaaaggtatctgaaggtatcgattttgatcatcaatatggcagaactgtg
ctgatgataggtatcccgtttcaatacacagaatcgcgtattttgaaagctcgcctagaa
ttcatgagggagaactatcgcatcagagaaaacgacttcttatctttcgatgcgatgaga
catgcagctcaatgtctggggagagtactgagagggaaggacgactatggtgtaatggta
ctagcagaccgtaggttttcaagaaaaagaagccagttaccaaaatggattgctcaaggt
ttgtctgacgccgatttgaacctttcgactgacatggccatatccaataccaaacaattc
ttgagaacaatggcacaacccacagaccctaaagaccaagagggtgtatctgtttggagt
tatgaagatttaataaagcaccagaatagcagaaaagatcaaggtggatttattgaaaac
gaaaacaaagaaggagaacaggatgaagatgaagatgaagatatagaaatgcagtga

DBGET integrated database retrieval system