KEGG   Saccharomyces cerevisiae (budding yeast): YFR031C
Entry
YFR031C           CDS       T00005                                 
Symbol
SMC2
Name
(RefSeq) condensin subunit SMC2
  KO
K06674  structural maintenance of chromosome 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YFR031C (SMC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YFR031C (SMC2)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Chromosome condensation proteins
   Condensin I
    YFR031C (SMC2)
   Condensin II
    YFR031C (SMC2)
SSDB
Motif
Pfam: SMC_N SMC_hinge GAS AAA_21 AAA_29 AAA_23 ABC_tran
Other DBs
NCBI-GeneID: 850589
NCBI-ProteinID: NP_116687
SGD: S000001927
UniProt: P38989
Structure
LinkDB
Position
VI:complement(216594..220106)
AA seq 1170 aa
MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRAS
SLQDLIYKRGQAGVTKASVTIVFDNTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLINGH
RAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSEILSLIEEAAGTKMFEDRREK
AERTMSKKETKLQENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDLEKTERIVVSYEYY
NIKHKHTSIRETLENGETRMKMLNEFVKKTSEEIDSLNEDVEEIKLQKEKELHKEGTISK
LENKENGLLNEISRLKTSLSIKVENLNDTTEKSKALESEIASSSAKLIEKKSAYANTEKD
YKMVQEQLSKQRDLYKRKEELVSTLTTGISSTGAADGGYNAQLAKAKTELNEVSLAIKKS
SMKMELLKKELLTIEPKLKEATKDNELNVKHVKQCQETCDKLRARLVEYGFDPSRIKDLK
QREDKLKSHYYQTCKNSEYLKRRVTNLEFNYTKPYPNFEASFVHGVVGQLFQIDNDNIRY
ATALQTCAGGRLFNVVVQDSQTATQLLERGRLRKRVTIIPLDKIYTRPISSQVLDLAKKI
APGKVELAINLIRFDESITKAMEFIFGNSLICEDPETAKKITFHPKIRARSITLQGDVYD
PEGTLSGGSRNTSESLLVDIQKYNQIQKQIETIQADLNHVTEELQTQYATSQKTKTIQSD
LNLSLHKLDLAKRNLDANPSSQIIARNEEILRDIGECENEIKTKQMSLKKCQEEVSTIEK
DMKEYDSDKGSKLNELKKELKLLAKELEEQESESERKYDLFQNLELETEQLSSELDSNKT
LLHNHLKSIESLKLENSDLEGKIRGVEDDLVTVQTELNEEKKRLMDIDDELNELETLIKK
KQDEKKSSELELQKLVHDLNKYKSNTNNMEKIIEDLRQKHEFLEDFDLVRNIVKQNEGID
LDTYRERSKQLNEKFQELRKKVNPNIMNMIENVEKKEAALKTMIKTIEKDKMKIQETISK
LNEYKRETLVKTWEKVTLDFGNIFADLLPNSFAKLVPCEGKDVTQGLEVKVKLGNIWKES
LIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFI
VVSLKEGMFANANRVFRTRFQDGTSVVSIM
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgaaggtagaggaattgattattgatggtttcaaatcatacgctacaagaacagtcatt
actgattgggaccctcaattcaatgctattacaggtctaaatgggtccggtaagtcgaac
attttggacgccatttgcttcgtgctcggtatagcatcaatgagcactgtgcgagcatct
agcctgcaagatttgatctataagcgtggtcaagcaggtgttaccaaggcaagcgtaacc
attgtttttgataataccgataaatcaaattctcccattgggttcactaactctcctcaa
atctctgttacaaggcaagtcgtgcttggtggaacttctaaatatctgataaatgggcat
agggcacctcaacagtcggttttgcaactatttcaatccgtgcagttaaatatcaataat
cctaattttttaatcatgcaaggtaaaattaccaaggttttgaatatgaaaccctcagag
atcttatcactgattgaagaggcagcagggacaaaaatgttcgaggatcgtagggaaaag
gcagaaagaacaatgtctaagaaagaaactaaattacaggagaacaggactctgttaact
gaagagatcgaacctaaactggaaaaacttcgaaacgaaaagagaatgttcctagaattt
cagtctactcagactgatttggaaaaaactgaacgaattgttgtatcctatgaatactat
aacattaaacataaacatacatcaataagagaaactctggagaacggtgagactcgtatg
aaaatgttaaatgaatttgttaagaaaacttccgaagaaatagacagtttgaatgaggat
gtcgaggaaatcaaacttcagaaagaaaaagaactacacaaagaaggcacaatctccaag
ttggaaaataaggagaacggtcttttaaatgaaatttctcgtttgaaaacttcactgtcg
ataaaagtagaaaatttgaatgatactactgaaaaatcaaaggctctggagtcagaaatt
gcaagttcctctgcaaagctaatcgaaaaaaaatcggcatacgctaacactgaaaaggat
tataaaatggtgcaggaacaactcagtaaacaaagggatctttataaacgaaaagaagaa
ttagtttccactttaaccacaggtatttcctcgaccggtgccgcagacggtggttataac
gcacagttggccaaggcaaagactgagctgaatgaagtctccttggcgataaaaaaatca
agcatgaaaatggagttgttgaagaaagagctattgacaattgaacctaaattaaaggag
gccacgaaagataacgagttaaatgtgaagcatgttaaacaatgccaagaaacgtgcgat
aaactacgagcccgactagtcgaatatgggtttgatccatcacgaattaaagacctgaag
caaagagaggataaattgaagagccattattatcaaacatgtaagaactctgaatattta
aaaagacgcgtaacaaatctggaatttaactatacgaaaccttatcctaattttgaagcc
agctttgtccatggggtggtgggtcaacttttccagatagataatgataatattcgctat
gctactgctttgcaaacttgtgccggaggtaggctattcaatgttgttgttcaagattct
cagacggccactcagctattagaaagaggaagattacgcaagcgtgttaccatcatacct
cttgataagatatatacgaggccaataagttctcaagtgcttgatttagccaagaaaatt
gctcctgggaaagttgaattggcaataaatttaataaggtttgatgaatctatcactaaa
gcgatggaatttatttttggaaatagtttaatctgtgaagatccggaaacagcaaagaaa
attaccttccatccaaagatccgcgctagaagtatcacccttcaaggtgatgtatacgac
ccagagggtacattgtctggtggtagtagaaatacctctgaatcgttattagttgatatt
caaaaatacaatcaaattcaaaaacaaattgagaccattcaggctgatctcaaccatgta
acggaagagctacagacgcaatatgctacatcgcaaaaaacaaagaccattcaaagtgat
ttaaatctctcgttgcataaattggatttggctaagcgtaatctcgacgcgaatccatct
tcccaaataattgctaggaatgaagaaattttgagggacattggagagtgtgagaatgaa
atcaaaaccaagcaaatgagcttaaagaaatgtcaagaagaagtttcgaccattgaaaaa
gacatgaaggagtacgatagcgataaaggatccaagttaaatgaattaaagaaggaattg
aaactattggcgaaagagctggaggagcaggaatcggagtcagaacgtaaatatgacttg
tttcaaaacttggaattagaaacagagcaattgagctcagaactagattctaataagacg
ctattgcataaccatttgaaatctattgaaagtttgaaattggaaaattctgatttggag
ggaaagatacgaggtgttgaagacgaccttgtaacagtccagacagaactgaacgaagaa
aagaaaaggttgatggacattgatgatgaactaaatgaattagaaacattgataaagaaa
aaacaggacgagaaaaaaagcagtgaattagaactacaaaaattggtccatgacttgaac
aaatataagtctaatacgaacaacatggaaaagataattgaagatctgcgacagaaacac
gaatttcttgaggattttgatctggtgagaaatatcgtcaaacaaaatgagggtatcgat
ttggatacttacagagaaaggagtaaacaattgaacgagaagtttcaagagctcagaaaa
aaagttaatccaaatattatgaatatgatagaaaatgttgagaaaaaggaggcagcatta
aaaacaatgattaaaacgattgaaaaagataagatgaaaatccaagagactatatcgaag
ttgaacgaatataaaagagaaactttagtcaaaacatgggagaaagtgacacttgatttt
ggtaatatttttgcagaccttttaccaaattcatttgcaaaattggttccatgcgaaggt
aaggacgtaacgcagggtttagaggttaaagtaaagcttggtaatatatggaaggaaagt
ttgattgaattgtccggtgggcaaaggtcgttgattgctttgtcattgattatggcattg
ttgcaatttcgaccagcgcctatgtatattttggatgaagttgatgctgctcttgattta
agtcatacgcaaaatataggtcatttgattaaaacaaggtttaaaggatctcagttcatt
gtagtctcgcttaaagaaggtatgtttgccaatgctaatagggtcttcaggacgagattt
caagatggtacctccgtagttagtataatgtga

DBGET integrated database retrieval system