KEGG   Saccharomyces cerevisiae (budding yeast): YFR036W
Entry
YFR036W           CDS       T00005                                 
Symbol
CDC26, HIT3, SCD26
Name
(RefSeq) anaphase promoting complex subunit CDC26
  KO
K03359  anaphase-promoting complex subunit 12
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YFR036W (CDC26)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YFR036W (CDC26)
   04113 Meiosis - yeast
    YFR036W (CDC26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YFR036W (CDC26)
   03036 Chromosome and associated proteins [BR:sce03036]
    YFR036W (CDC26)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     YFR036W (CDC26)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    YFR036W (CDC26)
SSDB
Motif
Pfam: ANAPC_CDC26
Other DBs
NCBI-GeneID: 850597
NCBI-ProteinID: NP_116694
SGD: S000001932
UniProt: P14724
Structure
LinkDB
Position
VI:226963..227337
AA seq 124 aa
MIRRAPTTLQLSHDDVTSLIDDLNEQKLKQQLNIEKTKYFQGKNGGSLHSNTDFQDTSQN
IEDNNNDNDNDIDEDDDMSSYNDKAASVAHTRVLNSLHLSTDSNTAHETSNANDNHNPFY
IREE
NT seq 375 nt   +upstreamnt  +downstreamnt
atgatcagaagggcccctaccaccttgcagctcagtcacgacgacgtaacctctctgatc
gatgacctgaacgagcagaaactcaagcagcagctgaatatcgagaagacaaaatacttc
caaggaaaaaatggcggatcgctgcactccaatacagactttcaggacacatcgcagaat
atcgaagacaacaataacgataacgataacgatatcgatgaagatgacgacatgtcatct
tacaacgacaaagcagcctcggtagcgcacaccagagtcctcaattccttgcatctgtcc
accgacagcaataccgcccacgagacgtccaatgcaaacgacaaccacaaccccttctac
atccgcgaggaataa

DBGET integrated database retrieval system