KEGG   Saccharomyces cerevisiae (budding yeast): YGL058W
Entry
YGL058W           CDS       T00005                                 
Symbol
RAD6, PSO8, UBC2
Name
(RefSeq) E2 ubiquitin-conjugating protein RAD6
  KO
K10573  ubiquitin-conjugating enzyme E2 A [EC:2.3.2.23]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YGL058W (RAD6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YGL058W (RAD6)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YGL058W (RAD6)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     YGL058W (RAD6)
Ubiquitin system [BR:sce04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   YGL058W (RAD6)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    YGL058W (RAD6)
SSDB
Motif
Pfam: UQ_con RWD UEV Leuk-A4-hydro_C
Other DBs
NCBI-GeneID: 852822
NCBI-ProteinID: NP_011457
SGD: S000003026
UniProt: P06104
Structure
LinkDB
Position
VII:393986..394504
AA seq 172 aa
MSTPARRRLMRDFKRMKEDAPPGVSASPLPDNVMVWNAMIIGPADTPYEDGTFRLLLEFD
EEYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPAS
PANVEAATLFKDHKSQYVKRVKETVEKSWEDDMDDMDDDDDDDDDDDDDEAD
NT seq 519 nt   +upstreamnt  +downstreamnt
atgtccacaccagctagaagaaggttgatgagagattttaaacgtatgaaggaagatgcc
ccaccgggtgtatctgcttcaccattacctgataacgtcatggtatggaacgccatgatt
atcgggccagccgatactccatatgaagacggaacttttaggttattgttggagtttgat
gaagaatatcccaataagccaccgcatgtcaaatttttgagtgaaatgtttcatcccaat
gtctatgcaaatggtgaaatttgtttggatattttgcagaacagatggactccaacatat
gatgtcgcatccatattgacatccattcaaagtttattcaacgatccaaatccagcttcg
ccagcaaacgttgaagctgcaacattattcaaagatcataaatcacagtacgtcaaaaga
gttaaggagacggtagagaaatcttgggaggatgatatggacgatatggacgatgatgat
gatgatgatgacgacgacgacgacgacgaagcagactga

DBGET integrated database retrieval system