KEGG   Saccharomyces cerevisiae (budding yeast): YGL090W
Entry
YGL090W           CDS       T00005                                 
Symbol
LIF1
Name
(RefSeq) Lif1p
  KO
K10982  ligase-interacting factor 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    YGL090W (LIF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YGL090W (LIF1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     YGL090W (LIF1)
SSDB
Motif
Pfam: DUF3042 TT1725
Other DBs
NCBI-GeneID: 852790
NCBI-ProteinID: NP_011425
SGD: S000003058
UniProt: P53150
Structure
LinkDB
Position
VII:343319..344584
AA seq 421 aa
MSQLTEFISCIPVVNEEQNEEDERGLCKIQIEDGAMLETLDENSLSGLRIEKMLVSEGTG
IFSKSSFGINDLRIFTGENIDEESKKYVWYELLKMLTGHKVYIASLDEKVVFTKWTCRMQ
DDEVWKVVMELESSAIIRKIAELTLHPVKKGEIDLFEMADKLYKDICCVNDSYRNIKESD
SSNRNRVEQLARERELLDKLLETRDERTRAMMVTLLNEKKKKIRELHEILRQNNIKLSDD
DVLDSALINTEVQKPISELNSPGKRMKRRKTVVEPQNLQKKLKDTSRRRANRKISNQSVI
KMEDDDFDDFQFFGLSKRPIITAKDKLSEKYDDITSFGDDTQSISFESDSSSDVQKHLVS
LEDNGIQISAGRSDEDYGDISGSESETDASAGEKKSSNHSEQSGNDREPCLQTESETDIE
T
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtcccagctgacggagttcattagctgtatccctgtggttaatgaagaacaaaatgaa
gaagatgagcgtggcctctgtaagattcagattgaagatggcgctatgttggaaacatta
gatgagaacagtctttcagggcttagaatagagaaaatgttggtaagtgaaggtacagga
attttttccaaaagcagttttggaatcaatgatttgcgaatctttacgggagaaaatatc
gatgaagagtctaagaaatatgtgtggtatgaactactcaaaatgttaactggtcacaaa
gtgtacattgcatcgttagacgaaaaagtcgtattcacaaaatggacgtgcagaatgcaa
gatgatgaggtatggaaagtagttatggagttggagtcatcggcgatcataagaaaaatc
gctgaacttaccttgcatccagtcaaaaagggagagattgatttatttgaaatggcagat
aaactctataaagatatctgttgtgttaacgattcttaccggaatataaaggagagcgat
tctagcaatagaaatcgagttgaacagctggctcgggaaagggagctattggataagctt
ttagaaacacgtgatgaaagaaccagagcaatgatggtaaccttgttgaatgagaagaag
aagaaaataagagagcttcatgagattctgcgacaaaataatatcaaattgtctgacgat
gatgttttagattctgcgcttattaatacggaagtgcaaaagccaatttctgagttaaac
tctccaggaaaaagaatgaaacgaagaaagacggtagtagagcctcaaaatttacaaaag
aagttgaaagacacaagtcggaggagagctaatagaaaaatatctaatcaatccgtgatc
aaaatggaagacgacgattttgatgactttcaatttttcggactttctaaaaggccaatt
attactgctaaagataaactcagtgaaaagtacgatgatattacctcttttggagatgac
acacaatcaataagttttgaatctgatagtagcagtgatgttcaaaaacatttagtgtct
ttagaagacaatggtattcaaatatcagcaggaagatcggatgaagattacggagacatt
tctggttctgaatctgagactgatgcaagtgcaggggaaaagaagagctccaaccatagt
gaacaatccggtaatgatagggaaccttgcttgcagacagaatcggaaacggatatagaa
acatag

DBGET integrated database retrieval system