KEGG   Saccharomyces cerevisiae (budding yeast): YGL141W
Entry
YGL141W           CDS       T00005                                 
Symbol
HUL5
Name
(RefSeq) ubiquitin-ubiquitin ligase HUL5
  KO
K10589  ubiquitin-protein ligase E3 C [EC:2.3.2.26]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YGL141W (HUL5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YGL141W (HUL5)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     YGL141W (HUL5)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  HECT type E3
   YGL141W (HUL5)
SSDB
Motif
Pfam: HECT
Other DBs
NCBI-GeneID: 852736
NCBI-ProteinID: NP_011374
SGD: S000003109
UniProt: P53119
LinkDB
Position
VII:238353..241085
AA seq 910 aa
MLNFTGQTRRRNVNLGNRTRNSKKDLLEKAKRERERRAQDKLKEDASKTIQKSIRRHFSN
VRLFKNTFTSSQLVHMIPAYGGKLIYYISQYDLQQLLKLSHNFLSSYPNSLGNRQLLSLL
KLYQDDALVAETLSDLNMDCPTVDEFLDSLSVYLCRASFLSYSSASKLADVIEAWEVMHS
SASISIFSISIGSYEKRPFALQFYCILAERNLLPQLINTNPILWDNMAKTYSHCSKGGQK
NIAKLLIPNFNNHIAPSVLRSDNDYVLKFYEKAFIDEVIATTANYVSDEDHVKNLMCYIA
SSPNQSCKNSVLITLLSNKDFVRRLSWEFFHTKFNASKTEAHPLFSVLAQLIDMHLLIST
DRELLDYNSVIPIEELKKFTSTLKDFTFRQYWELPKSERNPMLKEAVPLLSKVYERDSRL
HFLSTENNPTYWENSEKQFLNLRFYEELQEYEDLYREHLEEESDEDMEKEIDLDKERPPL
KSLLLNKMKKRLKSSLRFRKLEILLELPFFIPFEERVDLFYMFIALDKKRLSLDDDHNLI
NMFTPWASTGMRKQSAIISRDNVLEDAFNAFNSIGERFKASLDVTFINEFGEEAGIDGGG
ITKEFLTTVSDEGFKDPKHELFRTNDRYELYPSVVYDATKLKYIWFLGKVVGKCLYEHVL
IDVSFADFFLKKLLNYSNGFLSSFSDLGSYDSVLYNNLIKLLNMTTDEIKSLDLTFEIDE
PESSAKVVDLIPNGSKTYVTKDNVLLYVTKVTDYKLNKRCFKPVSAFHGGLSVIIAPHWM
EMFNSIELQMLISGERDNIDLDDLKSNTEYGGYKEEDQTIVDFWEVLNEFKFEEKLNFLK
FVTSVPQAPLQGFKALDPKFGIRNAGTEKYRLPTASTCVNLLKLPDYRNKTILREKLLYA
INSGARFDLS
NT seq 2733 nt   +upstreamnt  +downstreamnt
atgttaaacttcaccggtcaaacaaggagaagaaatgtcaatttagggaataggactcga
aattcaaagaaggatttactggaaaaggccaaaagggaacgtgaaaggagagcacaagat
aagctcaaagaagacgccagtaaaaccattcaaaaaagcatcagaagacatttttcaaat
gtgagactcttcaaaaacacatttactagttcgcaacttgttcatatgataccagcttac
gggggcaaattaatctattacatttctcaatatgatctgcagcaactgctaaaattatct
cataattttttgagttcttatcctaattctttaggcaacagacagctattgagcttgttg
aagctatatcaagatgatgcactggtggctgaaactctaagcgatcttaacatggactgc
cctacagttgacgaatttttagatagtctatccgtttatctctgtcgggcttcctttttg
agttattcctcagcttctaagctagctgatgtcatagaagcatgggaagtaatgcatagc
agtgcctccattagtattttttcgatatcgataggatcttacgaaaaacggccatttgca
ctacagttttattgcatacttgccgaaagaaaccttttgccccaacttatcaacacaaat
ccgatattatgggataacatggcaaagacatattcacactgtagtaaaggtggccaaaaa
aatatcgccaagctactcataccaaacttcaacaatcatattgctccatcagtcttgcgt
agtgataacgactatgtcttgaaattttatgaaaaggcatttatagacgaagttattgct
actactgcaaattacgtttctgatgaagatcacgtgaagaatttgatgtgctacattgca
agctctcccaatcaaagctgtaagaattctgtccttattaccttactgtctaacaaagac
ttcgtgagaaggctctcatgggaattctttcacactaaattcaacgccagcaagactgag
gctcaccccctgttttcagttttggcacagcttatcgacatgcaccttttaatatcgaca
gatcgggagttattagactacaactctgtgatacctatcgaagaactaaagaaatttaca
tccacgttaaaagattttactttccgacaatattgggaactacctaaaagtgaaaggaac
cctatgttaaaggaagcagtaccacttttgagcaaagtctacgaaagggactcaagattg
cactttctatccacggagaataatccaacctattgggaaaactctgaaaagcaattttta
aatttgagattttacgaagaattacaggagtacgaagatctgtatagagaacacttagaa
gaggaaagtgatgaggatatggaaaaggaaatagatcttgataaagaaaggcctcctttg
aagtctttattattgaacaaaatgaaaaagagattaaagtcatcattacgtttccgaaag
ttggaaatacttttggaattaccattttttattccttttgaagaaagggtggacttattt
tatatgttcatcgcactggacaagaagcgattatctttagatgacgatcacaacttgatc
aatatgtttaccccctgggcctccaccggtatgaggaagcaatccgctatcatctctagg
gataatgtcttagaagatgctttcaacgcatttaactctataggagaaaggttcaaagct
tcattagatgttacttttattaatgaatttggtgaagaagctggtattgatgggggcggc
attaccaaggaatttttaactactgtgtctgatgaaggatttaaagatccaaagcacgag
ttatttcggacgaatgatcgctacgaattatatccttctgttgtttatgacgctacgaaa
cttaagtatatatggtttctgggaaaggttgtaggcaaatgtctatatgagcatgttttg
atagatgtatcttttgctgatttctttttgaaaaaattattgaattactcgaacgggttt
ttatcttctttttctgatctgggaagctatgattcggtgttgtataataatttgatcaaa
ttattgaacatgaccactgacgagatcaagtctttagatttaacctttgaaatagatgag
cctgaaagttccgcaaaagttgttgacttaattccgaatggttcaaaaacgtacgtgacg
aaggataatgtgttgctctacgttactaaagtaacggattacaaattaaacaaaagatgc
ttcaaaccagtttcggcattccatggagggctcagtgttatcattgccccacattggatg
gagatgtttaactctatagaactacaaatgttaatatcaggtgagagagataatatcgat
ttagacgatctgaaatctaacacagaatacgggggttataaagaagaagatcagacaatt
gttgatttttgggaggttttgaatgagtttaagtttgaagagaaattgaattttttgaaa
tttgtcacgtccgttccgcaagctcctctgcaaggcttcaaggcattagatccaaaattt
ggtatcagaaatgcagggacagagaaatacaggctgcctacggcatctacctgtgttaat
ttattaaaattgccagattatagaaacaaaacaattttgagagagaaattattatatgca
ataaactcaggcgccaggtttgacttatcataa

DBGET integrated database retrieval system