KEGG   Saccharomyces cerevisiae (budding yeast): YGL190C
Entry
YGL190C           CDS       T00005                                 
Symbol
CDC55, TMR4
Name
(RefSeq) protein phosphatase 2A regulatory subunit CDC55
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03015  mRNA surveillance pathway
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    YGL190C (CDC55)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YGL190C (CDC55)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YGL190C (CDC55)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YGL190C (CDC55)
   03036 Chromosome and associated proteins [BR:sce03036]
    YGL190C (CDC55)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     YGL190C (CDC55)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     YGL190C (CDC55)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     YGL190C (CDC55)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 852685
NCBI-ProteinID: NP_011325
SGD: S000003158
UniProt: Q00362
LinkDB
Position
VII:complement(145809..147389)
AA seq 526 aa
MAQNNFDFKFSQCFGDKADIVVTEADLITAVEFDYTGNYLATGDKGGRVVLFERSNSRHC
EYKFLTEFQSHDAEFDYLKSLEIEEKINEIKWLRPTQRSHFLLSTNDKTIKLWKVYEKNI
KLVSQNNLTEGVTFAKKGKPDNHNSRGGSVRAVLSLQSLKLPQLSQHDKIIAATPKRIYS
NAHTYHINSISLNSDQETFLSADDLRINLWNLDIPDQSFNIVDIKPTNMEELTEVITSAE
FHPQECNLFMYSSSKGTIKLCDMRQNSLCDNKTKTFEEYLDPINHNFFTEITSSISDIKF
SPNGRYIASRDYLTVKIWDVNMDNKPLKTINIHEQLKERLSDTYENDAIFDKFEVNFSGD
SSSVMTGSYNNNFMIYPNVVTSGDNDNGIVKTFDEHNAPNSNSNKNIHNSIQNKDSSSSG
NSHKRRSNGRNTGMVGSSNSSRSSIAGGEGANSEDSGTEMNEIVLQADKTAFRNKRYGSL
AQRSARNKDWGDDIDFKKNILHFSWHPRENSIAVAATNNLFIFSAL
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggcacaaaacaattttgattttaaattcagccaatgttttggtgataaagcagatatt
gtggtgacagaggcggatctaattacagctgtagaatttgactatactggaaattatctg
gccactggtgataaaggtggccgtgtggtactttttgaaagaagtaatagtagacattgc
gaatataagtttttaacagagtttcaaagtcatgacgcagaatttgattatttaaaatcc
ttagaaattgaagagaagataaatgaaatcaaatggttacgaccaactcaaagatcacac
tttcttttgagcacaaatgataaaactataaaactttggaaagtttatgagaaaaatata
aaattggtaagccagaacaacttaacagaaggggttacgtttgcgaaaaaaggcaagccc
gataaccataacagtagaggaggctccgtgagggctgtattatctttacaatcgctgaaa
ctgcctcaattatcacagcatgacaaaatcattgctgccaccccaaagcgtatatatagt
aatgcacatacctatcacattaattcgatatcgttgaattctgatcaggaaacattttta
agtgctgacgacttgagaatcaatttatggaatctggacataccagatcagagcttcaac
atcgtagatatcaagccaaccaatatggaagaacttaccgaagtgatcacaagcgctgaa
tttcatccgcaagaatgtaatttattcatgtactcttcttccaaaggtacaataaagttg
tgtgatatgagacaaaattccctatgtgacaataaaaccaaaacatttgaagaatatttg
gatccaatcaatcataatttttttacagaaatcacgtcgtcaatttccgacataaaattt
agtccaaatggtaggtatattgcatccagagattatttaactgtcaaaatttgggacgta
aatatggataataagcctttgaaaaccataaacatacatgagcaattgaaggaaagattg
agtgatacctatgaaaacgatgcgattttcgataaatttgaagttaattttagtggtgat
agttcaagtgtaatgactggttcttacaataacaatttcatgatctatcctaatgtagta
acttctggtgataatgataatggcatagtcaaaacttttgatgaacacaacgcacctaat
agcaacagcaataaaaatatccacaacagcatacaaaataaagattctagtagtagtggc
aacagccacaagcgtaggagtaacggacgcaacacaggcatggtgggaagtagtaatagc
tctagaagcagtatagcgggaggagaaggagcaaattcggaggactcgggaaccgaaatg
aatgaaatcgtgttacaagctgacaaaacagcgttcaggaacaaaagatacggttcgcta
gcgcaaaggtctgcaagaaataaggattggggtgacgatattgatttcaagaagaatatt
ttacatttctcatggcatccaagagaaaatagtattgctgttgcagcaactaataattta
ttcattttttccgcattataa

DBGET integrated database retrieval system