KEGG   Saccharomyces cerevisiae (budding yeast): YGL201C
Entry
YGL201C           CDS       T00005                                 
Symbol
MCM6
Name
(RefSeq) MCM DNA helicase complex subunit MCM6
  KO
K02542  DNA replication licensing factor MCM6 [EC:5.6.2.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YGL201C (MCM6)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YGL201C (MCM6)
   04113 Meiosis - yeast
    YGL201C (MCM6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YGL201C (MCM6)
Enzymes [BR:sce01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     YGL201C (MCM6)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    YGL201C (MCM6)
SSDB
Motif
Pfam: MCM MCM_OB MCM6_C MCM_N MCM_lid Mg_chelatase Sigma54_activat GIDA_C AAA_3 AAA_5
Other DBs
NCBI-GeneID: 852673
NCBI-ProteinID: NP_011314
SGD: S000003169
UniProt: P53091
Structure
LinkDB
Position
VII:complement(117854..120907)
AA seq 1017 aa
MSSPFPADTPSSNRPSNSSPPPSSIGAGFGSSSGLDSQIGSRLHFPSSSQPHVSNSQTGP
FVNDSTQFSSQRLQTDGSATNDMEGNEPARSFKSRALNHVKKVDDVTGEKVREAFEQFLE
DFSVQSTDTGEVEKVYRAQIEFMKIYDLNTIYIDYQHLSMRENGALAMAISEQYYRFLPF
LQKGLRRVVRKYAPELLNTSDSLKRSEGDEGQADEDEQQDDDMNGSSLPRDSGSSAAPGN
GTSAMATRSITTSTSPEQTERVFQISFFNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEV
RPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVR
IQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGVEIVVPDVTQLGLPGVKPSST
LDTRGISKTTEGLNSGVTGLRSLGVRDLTYKISFLACHVISIGSNIGASSPDANSNNRET
ELQMAANLQANNVYQDNERDQEVFLNSLSSDEINELKEMVKDEHIYDKLVRSIAPAVFGH
EAVKKGILLQMLGGVHKSTVEGIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSG
KASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQT
ISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCN
EKIDTELASHIVDLHMKRDEAIEPPFSAEQLRRYIKYARTFKPILTKEARSYLVEKYKEL
RKDDAQGFSRSSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDV
DDVEMDEEFDNIESQSHAASGNNDDNDDGTGSGVITSEPPADIEEGQSEATARPGTSEKK
KTTVTYDKYVSMMNMIVRKIAEVDREGAEELTAVDIVDWYLLQKENDLGSLAEYWEERRL
AFKVIKRLVKDRILMEIHGTRHNLRDLENEENENNKTVYVIHPNCEVLDQLEPQDSS
NT seq 3054 nt   +upstreamnt  +downstreamnt
atgtcatccccttttccagctgacacaccaagcagtaatagaccttccaactcctctccg
ccaccatcgtcgataggtgctggcttcggaagcagtagcggactcgattcgcaaataggc
tctaggttacatttcccaagttcttctcaaccgcatgtcagtaattcacaaacaggccct
tttgttaacgattccactcagtttagttctcaaaggttgcaaaccgatggttccgcgact
aatgatatggagggaaatgaacctgccagaagcttcaaaagtagagctttgaatcacgtt
aagaaagttgatgacgttactggtgaaaaagtccgtgaagcgttcgagcagtttttggaa
gacttttccgttcaatccactgatactggtgaagttgaaaaagtttatagagctcaaatt
gaatttatgaaaatatatgacctaaacaccatttatatagattatcagcatttatccatg
agagaaaatggtgctctagctatggctatctcagaacaatattacagatttttgcctttt
ttacaaaagggtttaagaagagtagtaagaaagtatgcacctgaattgttaaacacaagt
gactcattgaagagatccgaaggtgacgaaggtcaagcggatgaagatgagcaacaggac
gatgatatgaatgggtcgagtctaccaagagattctggatcatcagccgcaccagggaat
gggacatctgccatggcaacgaggtcaataacaacttctacgtcacctgaacagacggaa
cgtgtttttcaaatcagtttcttcaatctaccaacagttcacagaattcgtgatataaga
tctgaaaagattggttcactattgagtatatcagggacagtgacaagaacatctgaggtc
cgtccagaattatacaaggcaagctttacgtgtgatatgtgccgtgctatcgtagataac
gtagaacagtccttcaagtacactgaaccgacattttgcccgaacccatcatgcgaaaat
agagccttttggacattaaatgttacaagatccaggtttcttgattggcaaaaagtcaga
attcaagaaaatgctaacgaaatacctacaggctccatgccgcgtacgctggacgtcatt
cttcgaggtgatagtgtcgaaagagccaagccaggtgaccgttgcaaatttacgggtgtg
gaaattgtagtacctgatgttacacaattggggctaccaggtgtgaagccaagttcaaca
ttagatactagaggtatttcgaagactactgaaggtttgaatagtggtgttactggttta
cgctctcttggtgttcgtgatttgacatacaagattagctttctggcatgccatgttatc
agtattggatcaaacattggtgcaagtagccctgatgcaaattctaacaaccgagaaact
gaactacagatggctgctaatttacaagctaataatgtataccaagataatgaaagagat
caagaagtattcttgaacagtttgagttcagatgaaataaatgagctgaaggaaatggta
aaggatgaacatatttatgataaattggtcagatctattgctccagctgtgtttggccat
gaagccgtaaagaagggtatcttgcttcagatgctcggtggtgttcataagagtactgta
gaaggtattaagttaagaggagatatcaacatctgtgttgttggtgatccctctacttct
aagtctcaatttttaaaatacgtagtgggatttgcaccaagatcagtttacacttccggt
aaggcctcgtcggctgctggtttaacagctgcggttgtgagagatgaggaaggaggtgat
tatacaattgaagcaggtgctttaatgcttgctgataacggtatttgttgtatcgatgaa
tttgataaaatggatatttcagatcaagttgccattcatgaagctatggaacaacagacc
atctctattgctaaagctggtattcacgctactttaaatgcaagaacatcaattctagcg
gctgccaacccggtaggtggaagatacaataggaaactatcactgaggggtaatttaaat
atgaccgcaccgatcatgtccagatttgatttattttttgttattcttgatgactgtaac
gaaaaaattgataccgaattggcatctcatatcgttgacttacacatgaaaagagacgaa
gccattgagccgccatttagtgcagaacaactacgtcgttatatcaaatatgcacgtact
tttaaaccaatattaacgaaagaagcccgttcctatttagtcgagaagtataaggaactg
agaaaggatgatgcccagggatttagtagatcgagttatagaatcacagttaggcaactt
gaaagtatgattagattatcagaagctattgcgagggctaattgtgtcgatgaaattact
ccatcattcattgcagaagcttacgatcttttaaggcaaagtattattcgtgttgatgtg
gatgatgtggaaatggatgaagaatttgataacatagagagtcaaagtcacgccgcttct
ggaaacaatgatgacaatgatgatgggactgggtcaggtgtaattacgagtgagccacca
gcagatatagaagaaggacaaagcgaagctacagctcgtccaggtacaagcgagaagaag
aaaacaacggtgacgtatgataaatatgtgtccatgatgaacatgatcgttagaaagatt
gctgaagtagatagggagggtgcagaagaactaacagctgtggatatagttgattggtat
ttattacagaaggaaaatgatttgggttcgttagcagaatattgggaagagagaagatta
gcgttcaaagtcataaaaaggttggtcaaagataggattttaatggagattcatggtacc
agacacaatttaagagatcttgagaatgaggaaaatgaaaataataaaactgtttatgtt
attcatccaaactgtgaggttttggatcaattggaaccacaggattccagctaa

DBGET integrated database retrieval system