KEGG   Saccharomyces cerevisiae (budding yeast): YIL143C
Entry
YIL143C           CDS       T00005                                 
Symbol
SSL2, LOM3, RAD25
Name
(RefSeq) TFIIH/NER complex ATPase/helicase subunit SSL2
  KO
K10843  DNA excision repair protein ERCC-3 [EC:5.6.2.4]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03022  Basal transcription factors
sce03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    YIL143C (SSL2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    YIL143C (SSL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YIL143C (SSL2)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YIL143C (SSL2)
Enzymes [BR:sce01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     YIL143C (SSL2)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     YIL143C (SSL2)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     YIL143C (SSL2)
SSDB
Motif
Pfam: ERCC3_RAD25_C Helicase_C_3 ResIII Helicase_C SNF2-rel_dom DEAD SBP_bac_6 Nbs1_C
Other DBs
NCBI-GeneID: 854663
NCBI-ProteinID: NP_012123
SGD: S000001405
UniProt: Q00578
Structure
LinkDB
Position
IX:complement(80510..83041)
AA seq 843 aa
MTDVEGYQPKSKGKIFPDMGESFFSSDEDSPATDAEIDENYDDNRETSEGRGERDTGAMV
TGLKKPRKKTKSSRHTAADSSMNQMDAKDKALLQDTNSDIPADFVPDSVSGMFRSHDFSY
LRLRPDHASRPLWISPSDGRIILESFSPLAEQAQDFLVTIAEPISRPSHIHEYKITAYSL
YAAVSVGLETDDIISVLDRLSKVPVAESIINFIKGATISYGKVKLVIKHNRYFVETTQAD
ILQMLLNDSVIGPLRIDSDHQVQPPEDVLQQQLQQTAGKPATNVNPNDVEAVFSAVIGGD
NEREEEDDDIDAVHSFEIANESVEVVKKRCQEIDYPVLEEYDFRNDHRNPDLDIDLKPST
QIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGITAACTIKKSVIVLCTSSVSVMQW
RQQFLQWCTLQPENCAVFTSDNKEMFQTESGLVVSTYSMVANTRNRSHDSQKVMDFLTGR
EWGFIILDEVHVVPAAMFRRVVSTIAAHAKLGLTATLVREDDKIGDLNFLIGPKLYEANW
MELSQKGHIANVQCAEVWCPMTAEFYQEYLRETARKRMLLYIMNPTKFQACQFLIQYHER
RGDKIIVFSDNVYALQEYALKMGKPFIYGSTPQQERMNILQNFQYNDQINTIFLSKVGDT
SIDLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRNDEGFNAFFYSLVSKDTQEMYYST
KRQAFLVDQGYAFKVITHLHGMENIPNLAYASPRERRELLQEVLLKNEEAAGIEVGDDAD
NSVGRGSNGHKRFKSKAVRGEGSLSGLAGGEDMAYMEYSTNKNKELKEHHPLIRKMYYKN
LKK
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgacggacgttgaaggctaccaacctaagagcaaggggaaaatctttccagatatgggt
gagtcctttttctcatcagatgaggattcaccagctactgatgcagagatcgatgagaac
tatgatgataacagggaaacgtcagaaggacgtggagaaagggataccggcgccatggta
acagggttgaagaagcctcggaaaaagaccaagagtagcaggcatacagcggcggattcc
tctatgaatcaaatggacgctaaggataaagcgcttttgcaggacactaatagcgatata
ccagcagatttcgttccagattccgtctctggaatgttcagaagccatgactttagttat
ttgcggttaagaccagaccatgcttccaggcccctttggatctcgccaagtgacggtagg
atcattctggagagtttctctccattagcagaacaggctcaggactttctggtcaccatt
gcagagcctataagtagaccctcccatattcatgaatacaagatcacagcatactctttg
tatgcagctgtttctgtagggttggagacggatgatatcatttcagttctggatagatta
tccaaagtacccgttgctgaatcgataatcaacttcattaaaggggctaccatttcatac
ggtaaagtgaaactagttattaagcataatagatatttcgtggagactacacaagcagat
attctgcaaatgttgctgaatgattccgtcatcgggcccctaagaatagatagcgatcat
caagtacagccaccagaggatgtactacagcaacaacttcagcaaaccgctggaaaaccc
gctactaatgttaatccgaacgatgtggaagccgtgtttagtgcagttataggtggtgat
aatgagcgggaagaagaagatgatgatattgatgccgttcactcctttgaaattgccaat
gagtctgttgaagtcgtaaagaaaagatgtcaagaaatcgattatcccgtgttggaagaa
tacgactttagaaacgaccatagaaacccggatttagatattgatttgaaaccttccact
caaatcagaccctatcaagaaaaatcgctgagtaaaatgtttggtaatgggcgtgctcgt
tcagggattattgttttgccatgtggcgcaggtaaaactttggtcggtattaccgcagca
tgtactataaaaaaatccgtaattgttttatgtacttcatcagtctccgtcatgcaatgg
aggcagcaatttttacaatggtgtaccttacaacctgaaaattgtgctgttttcacctct
gataataaggaaatgttccagacagaatccggtttggttgtttccacttattcaatggtg
gcaaacacaagaaacaggtctcatgattcacaaaaagttatggatttcttgaccggtagg
gaatgggggttcattattcttgacgaagttcatgtggtgcccgccgcaatgttccgtagg
gtggtctccaccatcgcagcacacgccaaattgggactgaccgcaacgctggttagagaa
gatgataaaattggtgatctgaattttttaattggtccaaaactttatgaagcaaattgg
atggaattatcccaaaaaggacatattgcaaatgtccaatgtgcagaggtttggtgtccc
atgacagcagaattttaccaagagtatttaagagaaactgcaaggaaaagaatgctactg
tatatcatgaatccaacaaagtttcaggcatgccaattcttaattcaatatcacgaaagg
aggggtgataagatcatcgttttttcagataatgtttacgccttacaagaatatgctttg
aaaatgggaaaaccatttatttatggttccacaccacaacaagagcgtatgaacattctg
caaaatttccagtacaatgaccaaatcaataccatatttctatcaaaagttggtgatact
tccatcgatttaccagaagctacctgtttaattcaaatatcttcgcactatgggtctcgt
cgtcaagaagcccaaagattaggaagaattttaagagctaaaagacgtaatgacgaaggt
ttcaatgcgttcttttattctctggtttctaaggatacgcaagaaatgtactactcaaca
aagagacaagcgtttttggtagatcaaggttacgcattcaaagtcattacacatttacac
ggaatggagaacattccaaatttggcatatgcttcacccagagaacgtagagagctattg
caagaagtattattgaagaacgaagaagctgctggtatcgaggtcggtgatgacgctgac
aattctgttgggagaggttcaaatggccacaaaagatttaaatcaaaggccgttagaggt
gaaggttcattgtctggtcttgctggcggtgaagatatggcatatatggaatacagtacc
aataaaaacaaagaactgaaggaacatcatccattaatcagaaagatgtattataagaat
ttgaagaagtga

DBGET integrated database retrieval system