KEGG   Saccharomyces cerevisiae (budding yeast): YKL113C
Entry
YKL113C           CDS       T00005                                 
Symbol
RAD27, ERC11, FEN1, RTH1
Name
(RefSeq) multifunctional nuclease RAD27
  KO
K04799  flap endonuclease-1 [EC:3.1.-.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03410  Base excision repair
sce03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YKL113C (RAD27)
   03410 Base excision repair
    YKL113C (RAD27)
   03450 Non-homologous end-joining
    YKL113C (RAD27)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YKL113C (RAD27)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YKL113C (RAD27)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YKL113C (RAD27)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     YKL113C (RAD27)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    YKL113C (RAD27)
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     YKL113C (RAD27)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     YKL113C (RAD27)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YKL113C (RAD27)
SSDB
Motif
Pfam: XPG_N XPG_I 5_3_exonuc HHH_5 CDKN3 5_3_exonuc_N HHH_2 MRPL52
Other DBs
NCBI-GeneID: 853747
NCBI-ProteinID: NP_012809
SGD: S000001596
UniProt: P26793
LinkDB
Position
XI:complement(224727..225875)
AA seq 382 aa
MGIKGLNAIISEHVPSAIRKSDIKSFFGRKVAIDASMSLYQFLIAVRQQDGGQLTNEAGE
TTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPDLKSHELTKRSSRRVETEKKLAEATTELE
KMKQERRLVKVSKEHNEEAQKLLGLMGIPYIIAPTEAEAQCAELAKKGKVYAAASEDMDT
LCYRTPFLLRHLTFSEAKKEPIHEIDTELVLRGLDLTIEQFVDLCIMLGCDYCESIRGVG
PVTALKLIKTHGSIEKIVEFIESGESNNTKWKIPEDWPYKQARMLFLDPEVIDGNEINLK
WSPPKEKELIEYLCDDKKFSEERVKSGISRLKKGLKSGIQGRLDGFFQVVPKTKEQLAAA
AKRAQENKKLNKNKNKVTKGRR
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgggtattaaaggtttgaatgcaattatatcggaacatgttccctctgctatcaggaaa
agcgatatcaagagcttttttggcagaaaggttgccatcgatgcctctatgtctctatat
cagtttttaattgctgtaagacagcaagacggtgggcagttgaccaatgaagccggtgaa
acaacgtcacacttgatgggtatgttttataggacactgagaatgattgataacggtatc
aagccttgttatgtcttcgacggcaaacctccagatttgaaatctcatgagttgacaaag
cggtcttcaagaagggtggaaacagaaaaaaaactggcagaggcaacaacagaattggaa
aagatgaagcaagaaagaagattggtgaaggtctcaaaagagcataatgaagaagcccaa
aaattactaggactaatgggaatcccatatataatagcgccaacggaagctgaggctcaa
tgtgctgagttggcaaagaagggaaaggtgtatgccgcagcaagtgaagatatggacaca
ctctgttatagaacacccttcttgttgagacatttgactttttcagaggccaagaaggaa
ccgattcacgaaatagatactgaattagttttgagaggactcgacttgacaatagagcag
tttgttgatctttgcataatgcttggttgtgactactgtgaaagcatcagaggtgttggt
ccagtgacagccttaaaattgataaaaacgcatggatccatcgaaaaaatcgtggagttt
attgaatctggggagtcaaacaacactaaatggaaaatcccagaagactggccttacaaa
caagcaagaatgctgtttcttgaccctgaagttatagatggtaacgaaataaacttgaaa
tggtcgccaccaaaggagaaggaacttatcgagtatttatgtgatgataagaaattcagt
gaagaaagagttaaatctggtatatcaagattgaaaaaaggcttgaaatctggcattcag
ggtaggttagatgggttcttccaagtggtgcctaagacaaaggaacagctggctgctgcg
gcgaaaagagcacaagaaaataaaaaattgaacaaaaataagaataaagtcacaaaggga
agaagatga

DBGET integrated database retrieval system