KEGG   Saccharomyces cerevisiae (budding yeast): YKL114C
Entry
YKL114C           CDS       T00005                                 
Symbol
APN1
Name
(RefSeq) DNA-(apurinic or apyrimidinic site) lyase APN1
  KO
K10771  AP endonuclease 1 [EC:4.2.99.18]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    YKL114C (APN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YKL114C (APN1)
Enzymes [BR:sce01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     YKL114C (APN1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     YKL114C (APN1)
SSDB
Motif
Pfam: AP_endonuc_2 DUF6650
Other DBs
NCBI-GeneID: 853746
NCBI-ProteinID: NP_012808
SGD: S000001597
UniProt: P22936
LinkDB
Position
XI:complement(223352..224455)
AA seq 367 aa
MPSTPSFVRSAVSKYKFGAHMSGAGGISNSVTNAFNTGCNSFAMFLKSPRKWVSPQYTQE
EIDKFKKNCATYNYNPLTDVLPHGQYFINLANPDREKAEKSYESFMDDLNRCEQLGIGLY
NLHPGSTLKGDHQLQLKQLASYLNKAIKETKFVKIVLENMAGTGNLVGSSLVDLKEVIGM
IEDKSRIGVCIDTCHTFAAGYDISTTETFNNFWKEFNDVIGFKYLSAVHLNDSKAPLGAN
RDLHERLGQGYLGIDVFRMIAHSEYLQGIPIVLETPYENDEGYGNEIKLMEWLESKSESE
LLEDKEYKEKNDTLQKLGAKSRKEQLDKFEVKQKKRAGGTKRKKATAEPSDNDILSQMTK
KRKTKKE
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgccttcgacacctagctttgttagatctgctgtctcgaaatacaaatttggtgcgcac
atgtcaggtgccggtggaatttctaatagtgtaactaatgcatttaacactggctgtaat
tcgtttgccatgtttttaaaatctccaagaaagtgggtttctccgcagtatacacaggag
gaaatagataaatttaagaaaaactgtgcaacttacaattataacccattgacggacgtc
ttaccgcatggccaatactttattaatttggctaatccggatagggaaaaggcagaaaag
agttatgagtcattcatggacgatctgaacaggtgtgagcaattagggataggcctgtat
aacttacatccaggttctactttgaaaggagaccatcagttgcagttaaaacaactagcc
tcatatttgaacaaagcaattaaggaaacgaaatttgttaaaattgtattagaaaatatg
gctggtactggaaatttagtaggaagttctctggtagatttgaaggaggttattggaatg
attgaagataaatcaagaatcggcgtttgcatagatacatgccatacatttgcagcaggc
tacgatatcagcaccactgaaacgtttaacaatttttggaaagagttcaatgatgtaata
gggttcaaatatctaagtgctgttcacttaaatgattccaaggctcctttaggagcaaat
agagatttgcatgaacgcttgggtcaaggttatttgggtatagatgtgtttagaatgatc
gcgcactctgaatacctgcagggtatccctattgtcttggaaactccatacgaaaatgat
gaaggctatggtaatgaaatcaaacttatggagtggttggaatcaaagagtgagagcgaa
ttgttagaagacaaggagtataaagaaaaaaatgatacgctgcagaaattaggtgctaaa
tcgcgtaaggaacagttagacaagtttgaggttaaacaaaagaagcgagctgggggcacc
aagaggaagaaagccactgcagagccaagcgataatgatatcttgtcacaaatgacaaag
aagaggaagactaagaaagaataa

DBGET integrated database retrieval system