KEGG   Saccharomyces cerevisiae (budding yeast): YKL210W
Entry
YKL210W           CDS       T00005                                 
Symbol
UBA1
Name
(RefSeq) E1 ubiquitin-activating protein UBA1
  KO
K03178  ubiquitin-activating enzyme E1 [EC:6.2.1.45]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YKL210W (UBA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YKL210W (UBA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YKL210W (UBA1)
Enzymes [BR:sce01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     YKL210W (UBA1)
Ubiquitin system [BR:sce04121]
 Ubiquitin-activating enzymes (E1)
  Ubiquitin activating enzyme
   YKL210W (UBA1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YKL210W (UBA1)
  Exosomal proteins of other body fluids (saliva and urine)
   YKL210W (UBA1)
  Exosomal proteins of colorectal cancer cells
   YKL210W (UBA1)
SSDB
Motif
Pfam: ThiF UBA_E1_SCCH E1_UFD E1_FCCH E1_4HB CBP_BcsR
Other DBs
NCBI-GeneID: 853670
NCBI-ProteinID: NP_012712
SGD: S000001693
UniProt: P22515
Structure
LinkDB
Position
XI:39163..42237
AA seq 1024 aa
MSSNNSGLSAAGEIDESLYSRQLYVLGKEAMLKMQTSNVLILGLKGLGVEIAKNVVLAGV
KSMTVFDPEPVQLADLSTQFFLTEKDIGQKRGDVTRAKLAELNAYVPVNVLDSLDDVTQL
SQFQVVVATDTVSLEDKVKINEFCHSSGIRFISSETRGLFGNTFVDLGDEFTVLDPTGEE
PRTGMVSDIEPDGTVTMLDDNRHGLEDGNFVRFSEVEGLDKLNDGTLFKVEVLGPFAFRI
GSVKEYGEYKKGGIFTEVKVPRKISFKSLKQQLSNPEFVFSDFAKFDRAAQLHLGFQALH
QFAVRHNGELPRTMNDEDANELIKLVTDLSVQQPEVLGEGVDVNEDLIKELSYQARGDIP
GVVAFFGGLVAQEVLKACSGKFTPLKQFMYFDSLESLPDPKNFPRNEKTTQPVNSRYDNQ
IAVFGLDFQKKIANSKVFLVGSGAIGCEMLKNWALLGLGSGSDGYIVVTDNDSIEKSNLN
RQFLFRPKDVGKNKSEVAAEAVCAMNPDLKGKINAKIDKVGPETEEIFNDSFWESLDFVT
NALDNVDARTYVDRRCVFYRKPLLESGTLGTKGNTQVIIPRLTESYSSSRDPPEKSIPLC
TLRSFPNKIDHTIAWAKSLFQGYFTDSAENVNMYLTQPNFVEQTLKQSGDVKGVLESISD
SLSSKPHNFEDCIKWARLEFEKKFNHDIKQLLFNFPKDAKTSNGEPFWSGAKRAPTPLEF
DIYNNDHFHFVVAGASLRAYNYGIKSDDSNSKPNVDEYKSVIDHMIIPEFTPNANLKIQV
NDDDPDPNANAANGSDEIDQLVSSLPDPSTLAGFKLEPVDFEKDDDTNHHIEFITACSNC
RAQNYFIETADRQKTKFIAGRIIPAIATTTSLVTGLVNLELYKLIDNKTDIEQYKNGFVN
LALPFFGFSEPIASPKGEYNNKKYDKIWDRFDIKGDIKLSDLIEHFEKDEGLEITMLSYG
VSLLYASFFPPKKLKERLNLPITQLVKLVTKKDIPAHVSTMILEICADDKEGEDVEVPFI
TIHL
NT seq 3075 nt   +upstreamnt  +downstreamnt
atgagcagcaataatagtggtctctctgccgccggagaaatcgatgaaagtctttattct
cgtcaactttatgtgttgggtaaggaagcaatgttgaaaatgcaaacctccaacgtatta
attctcggcttgaaggggctaggtgttgagatagcgaagaacgttgtgttggcaggtgtc
aaatctatgaccgtttttgaccctgagccggttcaattggcagacttatcaacccaattc
tttttgaccgaaaaggatattggtcaaaagagaggagatgtgaccagagccaaattggca
gagttgaacgcatatgtcccggttaatgtgctggattccttagacgatgttacccaattg
agtcaattccaggtcgttgtcgctacggacactgtttctttggaagataaggtgaaaatc
aacgaattttgccattcctccggtattagattcatttcctcggagacaagagggctgttt
ggtaacaccttcgtagacctaggtgacgagttcacagtgttggacccaacgggtgaagaa
cctcgcactggtatggtttcagacatcgagcccgatggaacagtgaccatgctagatgat
aacagacacgggttggaagacggaaattttgtcaggttctccgaagtagaaggtcttgat
aagttgaatgatgggaccctttttaaagttgaggttttggggccctttgcattcagaatt
ggttcagtcaaagaatatggcgagtataagaagggcggtatcttcaccgaagtcaaagta
ccccgtaaaatctcattcaagtctttgaaacaacaactgtccaatcctgagtttgttttt
tcggattttgctaaatttgacagagctgctcaattgcatttgggatttcaggctttacat
cagtttgccgttagacataatggtgaactgccaagaacaatgaatgacgaagacgccaat
gaattaatcaagttggtcaccgatttgtccgttcagcaaccggaggttctgggtgaaggt
gtagatgttaatgaagatttaatcaaagagctttcctatcaggcaagaggtgacataccg
ggtgtcgtagcatttttcggtggccttgtggcacaagaagtgttaaaagcatgttctggt
aaatttactccgctaaagcaatttatgtactttgattccttggaatcattgccagatcct
aaaaacttcccaagaaatgagaagactactcagccagtaaactctcgttacgataatcaa
atcgcggttttcggtttggattttcagaaaaagattgccaattcaaaggtctttcttgtc
ggatctggtgccattggttgtgagatgttgaaaaattgggcacttttggggcttggttct
ggctccgacggttacatcgttgttacggataacgattcgatcgaaaagtccaacttaaac
cgtcagttcttgtttagaccaaaggatgtcggaaagaacaaatctgaagtagcggcagag
gccgtttgtgctatgaaccccgatttgaagggcaagataaatgctaaaattgataaagtg
gggccagaaactgaggaaatatttaatgactccttttgggaaagcctggattttgtcacc
aacgctctagacaatgtcgacgcaagaacatacgtagatcgccgttgtgtgttttataga
aaaccactgttagaatctggtaccctaggtactaaaggtaatactcaagtcatcattcca
agattgactgaatcatactcttcttctagagacccaccagaaaagtctatcccattgtgt
accctacgttctttcccaaacaagattgatcacaccattgcctgggccaaatctcttttc
caaggttacttcactgattccgccgaaaacgttaatatgtacttgacacaaccgaatttc
gttgagcaaacactaaagcaaagcggggatgtcaagggagttctagaatccatctcagat
tctctatctagtaaaccacacaattttgaagattgtatcaaatgggcaaggttagaattt
gaaaaaaaattcaaccatgatatcaagcagttactgttcaacttccccaaggatgccaag
acttccaacggtgaaccattttggtccggtgctaagcgtgctccaacaccattagagttt
gatatttacaataacgatcacttccattttgtcgtagcaggtgctagtttacgcgcttat
aattatggtattaaaagtgatgactctaattctaaacccaacgtggacgagtataagtcc
gtcatcgatcatatgataattccagaatttactccaaatgccaatttgaaaattcaagtt
aatgacgatgatccggatccaaatgccaacgcggctaatggctcagatgaaattgatcag
ctggtatcatccctaccagatccttctactttggctggctttaaactggagcctgtagat
ttcgagaaagacgatgacactaatcatcatattgaatttataacggcttgttctaactgt
agagctcaaaactacttcatcgaaactgctgatcgccaaaagaccaaattcatagctggc
cgtattattcctgccatcgcaacaaccacttctttggttactggtttggtcaatttggaa
ttatataaactgattgacaacaagacagatattgagcaatataagaatggctttgttaat
ttagctttgccatttttcggtttttcggaaccaattgcttcaccaaagggagaatataac
aacaagaaatatgataaaatttgggatagatttgatatcaagggagatattaaattaagt
gatttaattgaacattttgaaaaagatgaagggttagaaataacaatgctttcttatggc
gtttctcttctttatgcctcatttttccctccaaagaaattgaaagaaagactaaatcta
ccaataactcaattggttaaattagtgactaagaaagatattccggcacatgtatctaca
atgattctcgaaatttgcgcagatgacaaggaaggagaggatgttgaagttcctttcatt
accattcatctatga

DBGET integrated database retrieval system