KEGG   Saccharomyces cerevisiae (budding yeast): YLR018C
Entry
YLR018C           CDS       T00005                                 
Symbol
POM34
Name
(RefSeq) Pom34p
  KO
K18724  nucleoporin POM34
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  Nucleocytoplasmic transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    YLR018C (POM34)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YLR018C (POM34)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YLR018C (POM34)
SSDB
Motif
Pfam: NPCC
Other DBs
NCBI-GeneID: 850705
NCBI-ProteinID: NP_013118
SGD: S000004008
UniProt: Q12445
LinkDB
Position
XII:complement(178707..179606)
AA seq 299 aa
MKIQAGQLGLDDNDVPGPLPDTDSKPSSQSQNDTPMFKLGNFESPVLKELSRRTVNKEME
TQRIMTNVIAFAFWNLLVKFIKFFWNNTHVGRQFCNRLSRIHLYMLTFHTLKKANIIYHT
TFSWLNAELLDYLFHLLISLNILFSLWKLLSTVKVSDLNLTDRQKKLLGVDMQSSVDTGL
QPQHPHYVSTSKISQMAQNKTHIPQTNLKNHPAYLFKGLETPLKARQREMAEEQTKLQSQ
SLHTKNVFGTLQRHSGISSTLVSANNDNNSPHTPVTRKGYIPSSKYAYMMNSQSPRGKI
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaagattcaggcgggccaattgggcctggacgataatgacgtgccgggaccattgccg
gacacagacagcaaaccctcatcacaatcacaaaatgacacaccaatgtttaaattgggc
aactttgaaagtcctgtgctcaaggagctatcacggcgaacggtaaacaaggaaatggag
acgcagagaattatgacaaacgtaattgcgtttgcgttctggaacctgctggtgaagttc
atcaagttcttttggaacaacactcatgttgggagacagttttgcaaccggctatccaga
atccatctgtacatgttgacatttcacacgttaaagaaggctaacatcatatatcacacc
acgttcagttggttgaatgcagaacttcttgactacttgttccacctattaatctcgctc
aatatactgttttctctttggaagctcttatccaccgtcaaagtaagtgatttgaatctc
actgacaggcaaaagaagctcctgggggtagacatgcaatcatctgtcgatactgggttg
cagccacaacacccccactacgtatccacttctaagatcagccaaatggcacagaacaaa
acacatattcctcaaacaaatctcaaaaatcatccagcatatctcttcaaaggcttagag
acgcctttgaaagcaagacaaagggaaatggcggaggaacagacgaaactacaatctcaa
tccttacacacaaagaatgtatttggcacactgcagaggcatagcggtatcagtagcaca
ttagtgagcgctaacaatgacaataactcgccgcatacccctgtaactaggaagggctac
attccaagtagcaaatatgcatatatgatgaactcacagtccccaagggggaaaatataa

DBGET integrated database retrieval system