KEGG   Saccharomyces cerevisiae (budding yeast): YLR182W
Entry
YLR182W           CDS       T00005                                 
Symbol
SWI6, PSL8, SDS11
Name
(RefSeq) transcriptional regulator SWI6
  KO
K06648  regulatory protein SWI6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YLR182W (SWI6)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YLR182W (SWI6)
   04113 Meiosis - yeast
    YLR182W (SWI6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YLR182W (SWI6)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   ZIP only
    YLR182W (SWI6)
SSDB
Motif
Pfam: Swi6_N Ank_2 Ank_5 Ank_3 Ank Ank_4 TPR_MLP1_2 FAP206 Phage_GPO DUF3287 Lectin_N COG5 GAS Baculo_PEP_C
Other DBs
NCBI-GeneID: 850879
NCBI-ProteinID: NP_013283
SGD: S000004172
UniProt: P09959
Structure
LinkDB
Position
XII:517940..520351
AA seq 803 aa
MALEEVVRYLGPHNEIPLTLTRDSETGHFLLKHFLPILQQYHDTGNINETNPDSFPTDEE
RNKLLAHYGIAVNTDDRGELWIELEKCLQLLNMLNLFGLFQDAFEFEEPETDQDEEDPSH
SKLPENKTKSENSKDNISSKRINNLQDMSLDSDAHRELGSPLKKLKIDTSVIDAESDSTP
NTARGKPNDDINKGPSGDNENNGTDDNDRTAGPIITFTHDLTSDFLSSPLKIMKALPSPV
VNDNEQKMKLEAFLQRLLFPEIQEMPTSLNNDSSNRNSEGGSSNQQQQHVSFDSLLQEVN
DAFPNTQLNLNIPVDEHGNTPLHWLTSIANLELVKHLVKHGSNRLYGDNMGESCLVKAVK
SVNNYDSGTFEALLDYLYPCLILEDSMNRTILHHIIITSGMTGCSAAAKYYLDILMGWIV
KKQNRPIQSGTNEKESKPNDKNGERKDSILENLDLKWIIANMLNAQDSNGDTCLNIAARL
GNISIVDALLDYGADPFIANKSGLRPVDFGAGTSKLQNTNGGDENSKMVSKGDYDGQKNG
KAKKIRSQLLKNPPETTSLINDVQNLLNSISKDYENETVQYNEKLEKLHKELNEQREELA
NSREQLANVKQLKDEYSLMQEQLTNLKAGIEEEEESFREESKKLGIIADESSGIDWDSSE
YDADEPFKVEFLSDFLEDKLQKNYEGDISKLLEAESKEQIMEQIRNQLPAEKIQSMLPPT
VLLKARINAYKRNDKHLTNVLDTISTKQSELENKFRRVLSLCLKIDENKVDNMLDGLLQA
ISSEDPQDIDTDEMQDFLKKHAS
NT seq 2412 nt   +upstreamnt  +downstreamnt
atggcgttggaagaagtggtacgatacttaggacctcacaatgagatccctttgacactc
actagagactcggagactggccatttcctcctgaaacattttctgcccattttgcagcaa
tatcatgacacggggaatattaacgagaccaaccccgatagtttccccactgatgaggaa
agaaataaattactggcacattatggaattgctgtaaatacagacgaccgaggtgagtta
tggatagagctggaaaaatgtttacaattattaaacatgctaaatttattcggtttgttc
caggatgcattcgaatttgaggagcctgaaacagatcaggatgaagaagatcccagccat
tcgaaactaccagaaaacaagaccaaaagtgaaaattctaaggataatatcagctcaaag
aggattaataatttacaagatatgagcctggattctgatgcacacagagaattaggctct
cctttaaaaaaactaaaaatagatacctctgtaatagatgctgagagtgactccactccg
aatactgccagaggcaagcctaacgatgatattaataagggccctagcggcgacaatgaa
aataatggcactgatgacaatgacagaaccgctggacctatcataacattcactcatgac
ctaacttctgactttttaagcagtccactgaaaatcatgaaagcactaccttctccagtt
gtaaatgataatgaacagaagatgaaactagaggcattcttacaacggttgttatttcca
gaaattcaagaaatgcctacatcccttaataatgacagcagtaatagaaattcagaaggg
gggagctcaaaccaacaacaacagcacgtatcatttgatagccttttgcaagaggtaaac
gacgcttttcctaatactcaattaaatcttaatattcctgtagatgagcatggaaacaca
ccattacattggctgacttcaatagcaaacctggaattagtgaaacacctggttaagcat
ggttcaaacagattatatggtgataatatgggggagtcatgcctagtgaaagctgtcaaa
tcagtaaataattacgactctggtacttttgaggcacttctagattatttatatccatgt
ttaattttggaagactcaatgaatagaacaattttgcaccatatcattattacgtctggt
atgactggctgttcagcagctgcgaaatattatttagatattttaatgggatggattgtc
aagaaacaaaatagacccattcaaagtggtactaacgaaaaagaaagcaaaccgaatgac
aaaaatggggaaagaaaggactctatactagaaaatttggacctgaaatggataatagca
aacatgctcaatgcgcaggactctaatggcgatacttgcttgaacattgcagcaagattg
ggaaacatttcaatagtagacgctttattagattacggtgctgacccatttattgcaaac
aaatcagggttgagacccgtggattttggggcaggtacttcaaaattacaaaatacgaac
ggcggtgacgaaaactcgaagatggtctctaagggtgattacgacggtcaaaaaaatgga
aaggccaaaaaaataaggtctcaactgttgaaaaacccacctgaaacaacttcgttaatt
aatgatgtccaaaatttactgaattcaatctcgaaagattatgagaatgaaacagtgcaa
tataatgagaaattagaaaaactacacaaggaattgaacgaacagcgagaagaattagct
aattctagagaacaactagcaaatgtgaagcaattgaaagatgaatactcactaatgcaa
gagcaattgaccaatttaaaagcaggaattgaagaagaagaggaaagttttagggaagag
agcaaaaagctaggaataattgcagatgaaagttcaggtattgattgggactctagcgaa
tatgatgcagatgaacccttcaaagtagagttcctttcagatttcttggaggataaatta
caaaagaattatgaaggcgatatttccaaactattagaagcggagtcgaaagagcagata
atggaacagatacgaaatcaacttcccgcagaaaaaatccaatcgatgcttccaccaacg
gtcttattgaaggcaagaataaatgcatacaagcggaatgataaacacctaaccaatgta
ttggatacaatcagcaccaaacaatcagaattagagaataaatttagaagagtgttatct
ttatgtttgaaaatcgacgaaaataaagttgacaatatgcttgatggtttgttacaggcc
atatcttctgaagacccacaagacattgacactgacgaaatgcaagattttttaaaaaag
catgcttcatga

DBGET integrated database retrieval system