KEGG   Saccharomyces cerevisiae (budding yeast): YLR265C
Entry
YLR265C           CDS       T00005                                 
Symbol
NEJ1, LIF2
Name
(RefSeq) Nej1p
  KO
K10983  non-homologous end-joining protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    YLR265C (NEJ1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YLR265C (NEJ1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     YLR265C (NEJ1)
SSDB
Motif
Pfam: XLF
Other DBs
NCBI-GeneID: 850970
NCBI-ProteinID: NP_013367
SGD: S000004255
UniProt: Q06148
LinkDB
Position
XII:complement(674427..675455)
AA seq 342 aa
MDSELKGQQLSDAEWCVKKINGEGNCLLLFLPMSSPTTIVMIVLVSLERLVPYVFKLSQT
QLSQQCQSQGFTDSISLNLIKLKLMDILQAPQEINQIGLVDSNLVFSFDVSADITVSINS
VPSHVTKDMFYMILQSLCMLLLKLVNLSTQYHYVQRDILNEKQKCLDFLLISLRDLDGGS
KVISQWAPENSKNYESLQQCTDDDIIKKLLHKGKFQHQEFLADSLKTLLSLRNKFQDVSR
FEESGELNKKERVRFPAVNHFYNDDFELQADPTNEARPNSRGKIKPKTDFKPKSRESSTS
SQLRLENFSESEATPEKTKSSSSLVEEYPQKKRKFGKVRIKN
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggattctgagttgaaagggcagcagctaagtgatgcagaatggtgtgttaaaaaaatt
aatggtgagggaaattgtctcctattatttctaccgatgtcatctccaaccacaattgta
atgattgttttagtttccttggagcgcttagttccctacgttttcaaactttcacaaact
caattatcacagcaatgccagagccaaggttttacggatagtatatcattaaatctaatt
aaactaaaactaatggacattctacaagctcctcaagaaattaaccaaattggattggta
gattcaaatttggtttttagtttcgatgtatctgcggatattacagtttccataaatagc
gtaccttcacatgttactaaggatatgttctatatgattttgcaaagtttatgcatgctt
ttattaaaattggtaaacctttccacccaataccactatgtacaacgggatattttgaat
gaaaagcaaaaatgcttagattttcttttaatttctcttcgtgatttagacggtgggagt
aaagttatcagtcaatgggctcctgaaaattctaagaattatgaatctctgcagcaatgc
acagacgatgacataatcaaaaaattactacataaaggaaaattccagcatcaagaattt
ctggcggactcattaaaaacattattatctttaagaaacaaatttcaagatgtgtcgcgg
tttgaagaatctggagaacttaacaaaaaagagcgcgtcagatttcctgcggtgaatcat
ttttataatgatgattttgaattgcaagcagaccctacaaatgaggctcgaccaaatagc
cgcggtaaaattaaaccaaagacagatttcaagccaaaatctagagaaagtagtaccagt
tcgcaacttcgcctggagaatttttctgaatctgaggctacaccagaaaaaacaaaatca
agttcttctttggtcgaagaatacccacagaaaaaaagaaaatttggaaaggtgagaata
aaaaactaa

DBGET integrated database retrieval system