KEGG   Saccharomyces cerevisiae (budding yeast): YML021C
Entry
YML021C           CDS       T00005                                 
Symbol
UNG1
Name
(RefSeq) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    YML021C (UNG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YML021C (UNG1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     YML021C (UNG1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     YML021C (UNG1)
 Prokaryotic type
     YML021C (UNG1)
SSDB
Motif
Pfam: UDG
Other DBs
NCBI-GeneID: 854987
NCBI-ProteinID: NP_013691
SGD: S000004483
UniProt: P12887
LinkDB
Position
XIII:complement(229734..230813)
AA seq 359 aa
MWCMRRLPTNSVMTVARKRKQTTIEDFFGTKKSTNEAPNKKGKSGATFMTITNGAAIKTE
TKAVAKEANTDKYPANSNAKDVYSKNLSSNLRTLLSLELETIDDSWFPHLMDEFKKPYFV
KLKQFVTKEQADHTVFPPAKDIYSWTRLTPFNKVKVVIIGQDPYHNFNQAHGLAFSVKPP
TPAPPSLKNIYKELKQEYPDFVEDNKVGDLTHWASQGVLLLNTSLTVRAHNANSHSKHGW
ETFTKRVVQLLIQDREADGKSLVFLLWGNNAIKLVESLLGSTSVGSGSKYPNIMVMKSVH
PSPLSASRGFFGTNHFKMINDWLYNTRGEKMIDWSVVPGTSLREVQEANARLESESKDP
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtggtgcatgagaagattgccaacaaattcagttatgacggtggctcgaaagagaaag
caaactacgatcgaagacttctttggtacaaagaaaagcactaatgaggcgcccaataag
aaaggtaaatcgggcgctactttcatgaccataacaaatggcgcagctatcaagacagag
acaaaggcggtcgcaaaggaggcaaacacggacaaatatcctgctaattcaaatgcaaaa
gatgtatattcgaagaacttgagcagcaatttacgtacactactgtcgctggagctagaa
acgattgatgattcgtggtttccacatttaatggatgaatttaaaaagccatattttgta
aagttgaaacagtttgtcactaaagagcaagctgatcatacagtatttccgcctgcaaag
gatatttactcatggaccaggctaacgccttttaataaagttaaagtcgtgattatcggt
caagatccctaccacaactttaatcaggcgcatggcttggcttttagcgtcaaaccccct
acaccagcaccaccgtcattaaagaacatatataaggaactgaagcaagagtatcctgat
tttgttgaagataataaagtgggagatttaactcactgggcttcacaaggggttttattg
cttaatacctcgttaactgtaagagcacataatgcaaactcgcattctaagcatggttgg
gaaacttttacaaaaagggtagttcagttgttgatccaggacagagaggccgacggtaag
agtttagtattcctcttatgggggaacaatgctatcaaattagtagagtctctgttggga
tctacttccgttggaagcggtagtaagtaccctaatatcatggtgatgaagtcagtgcat
ccgtctccattaagtgcaagtagaggattttttggtaccaaccatttcaaaatgataaac
gattggctatacaatacccgcggagagaaaatgatagactggagtgttgttcctggaacg
tcattaagagaagttcaggaggcaaatgctcgcttagagtcagaatcaaaggacccttga

DBGET integrated database retrieval system