KEGG   Saccharomyces cerevisiae (budding yeast): YML032C
Entry
YML032C           CDS       T00005                                 
Symbol
RAD52
Name
(RefSeq) recombinase RAD52
  KO
K10873  DNA repair and recombination protein RAD52
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YML032C (RAD52)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YML032C (RAD52)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad52 family proteins
     YML032C (RAD52)
SSDB
Motif
Pfam: Rad52_Rad22
Other DBs
NCBI-GeneID: 854976
NCBI-ProteinID: NP_013680
SGD: S000004494
UniProt: P06778
LinkDB
Position
XIII:complement(212515..213930)
AA seq 471 aa
MNEIMDMDEKKPVFGNHSEDIQTKLDKKLGPEYISKRVGFGTSRIAYIEGWRVINLANQI
FGYNGWSTEVKSVVIDFLDERQGKFSIGCTAIVRVTLTSGTYREDIGYGTVENERRKPAA
FERAKKSAVTDALKRSLRGFGNALGNCLYDKDFLAKIDKVKFDPPDFDENNLFRPTDEIS
ESSRTNTLHENQEQQQYPNKRRQLTKVTNTNPDSTKNLVKIENTVSRGTPMMAAPAEANS
KNSSNKDTDLKSLDASKQDQDDLLDDSLMFSDDFQDDDLINMGNTNSNVLTTEKDPVVAK
QSPTASSNPEAEQITFVTAKAATSVQNERYIGEESIFDPKYQAQSIRHTVDQTTSKHIPA
SVLKDKTMTTARDSVYEKFAPKGKQLSMKNNDKELGPHMLEGAGNQVPRETTPIKTNATA
FPPAAAPRFAPPSKVVHPNGNGAVPAVPQQRSTRREVGRPKINPLHARKPT
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgaatgaaattatggatatggatgagaagaagcccgttttcggtaaccattccgaggac
atacagaccaaattggacaagaaattaggacctgagtatatctccaagagagttgggttt
ggaacaagcaggattgcatacatcgaaggttggagagtaattaatcttgctaatcaaatc
tttggatataatggctggtctacggaggtaaaaagtgtagttatcgattttttggatgag
cgacagggaaagtttagcatagggtgtactgcaattgttcgtgttacgttgactagcggg
acttatagggaagatattgggtatggtaccgtggagaacgaaagacggaaacctgccgct
ttcgaaagggccaagaaatctgccgttacggatgccttgaaaagatctttgagagggttt
ggtaatgctctaggaaattgtctttacgataaagattttctggcaaagatcgataaggtg
aagttcgatccgccagattttgacgaaaacaatttgtttaggccaacggatgaaatcagc
gaaagctcaagaacgaatactttgcatgaaaatcaagaacaacaacaatacccgaataaa
agaaggcaattgactaaagttacaaataccaatcccgactcgacgaagaacctggtgaaa
atagaaaatacagtaagtcgaggtaccccaatgatggccgcacctgctgaggctaacagt
aaaaacagcagtaataaagatactgatctcaaatctctcgatgcttccaaacaggatcaa
gatgaccttctcgatgattctcttatgtttagcgatgattttcaagacgacgacttgata
aatatgggcaacacaaacagtaatgttttaacgacagagaaggatcccgttgtagctaag
caaagcccaactgctagctcaaacccagaggcagaacaaatcacctttgttacagctaag
gctgcaacttccgtacaaaatgaacgttatattggtgaagagagcatttttgatcccaaa
taccaggcacaatccattaggcacaccgttgatcagactacgtccaagcatattccagcg
agtgtgctaaaagacaaaacgatgaccaccgcgagggattctgtctatgaaaaatttgca
ccaaagggaaaacaattgagcatgaagaacaatgataaagaactggggcctcatatgcta
gaaggggctgggaatcaagtaccgcgtgaaaccacaccaattaaaacgaacgctacagct
tttccgcctgcagctgctccacggtttgcgccgccttctaaggtagtacatcctaatgga
aatggtgcagtgccagccgttccgcaacaaagatcgacacgaagagaagttggaagacca
aagatcaatcccctgcatgcacgcaagcctacttga

DBGET integrated database retrieval system