KEGG   Saccharomyces cerevisiae (budding yeast): YML060W
Entry
YML060W           CDS       T00005                                 
Symbol
OGG1
Name
(RefSeq) 8-oxoguanine glycosylase OGG1
  KO
K03660  N-glycosylase/DNA lyase [EC:3.2.2.- 4.2.99.18]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    YML060W (OGG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YML060W (OGG1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-
     YML060W (OGG1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     YML060W (OGG1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     YML060W (OGG1)
SSDB
Motif
Pfam: HhH-GPD OGG_N
Other DBs
NCBI-GeneID: 854942
NCBI-ProteinID: NP_013651
SGD: S000004525
UniProt: P53397
LinkDB
Position
XIII:151871..153001
AA seq 376 aa
MSYKFGKLAINKSELCLANVLQAGQSFRWIWDEKLNQYSTTMKIGQQEKYSVVILRQDEE
NEILEFVAVGDCGNQDALKTHLMKYFRLDVSLKHLFDNVWIPSDKAFAKLSPQGIRILAQ
EPWETLISFICSSNNNISRITRMCNSLCSNFGNLITTIDGVAYHSFPTSEELTSRATEAK
LRELGFGYRAKYIIETARKLVNDKAEANITSDTTYLQSICKDAQYEDVREHLMSYNGVGP
KVADCVCLMGLHMDGIVPVDVHVSRIAKRDYQISANKNHLKELRTKYNALPISRKKINLE
LDHIRLMLFKKWGSYAGWAQGVLFSKEIGGTSGSTTTGTIKKRKWDMIKETEAIVTKQMK
LKVELSDLHIKEAKID
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgtcttataaattcggcaaacttgccattaataaaagtgagctatgtctagcaaatgtg
ctacaggctggccaatcctttcgatggatttgggatgaaaagttaaaccagtacagcact
acaatgaagataggccagcaagaaaagtattcagtagtgattttgaggcaagatgaagag
aatgagatcctggaatttgttgctgtcggcgactgtggcaatcaggacgccttaaaaact
catctaatgaaatattttagattggacgtgtcactgaagcacttattcgataatgtttgg
attccaagcgataaagcatttgcgaaactttctccacaaggcatccgtatcttggcccag
gaaccatgggagacattgatttcctttatttgctcgagtaataataacatttcaagaatt
acgagaatgtgcaatagcctttgctctaatttcgggaacttaatcacaacaatagatggg
gtcgcctaccattcgtttcctacaagtgaggagctaacttctcgagccactgaagccaag
ttgcgtgagctgggctttggatatagagctaagtatattatcgaaaccgcgagaaaactg
gtgaatgataaagctgaagctaatattacttctgacaccacataccttcaaagtatctgt
aaagatgctcaatatgaagacgttagagagcacctcatgtcctacaatggtgtaggcccc
aaagttgctgattgcgtttgtctaatgggacttcacatggatggcatcgtccccgtagat
gtccatgttagtagaattgcgaagagggactaccaaatatctgcgaacaagaaccatctc
aaagaattgaggacaaaatacaacgccttacctatctcaagaaaaaaaatcaacctagag
ctcgaccatattagattaatgctttttaaaaaatggggatcatacgctggttgggcccaa
ggtgtcctattctctaaagaaatcggagggactagtggtagcactacaactggtactata
aagaagagaaaatgggatatgataaaggaaacggaagcaattgttacgaaacaaatgaaa
ctgaaagttgaattgtctgatcttcacatcaaagaagcaaaaatagattag

DBGET integrated database retrieval system