KEGG   Saccharomyces cerevisiae (budding yeast): YMR043W
Entry
YMR043W           CDS       T00005                                 
Symbol
MCM1, FUN80
Name
(RefSeq) transcription factor MCM1
  KO
K12412  pheromone receptor transcription factor
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YMR043W (MCM1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YMR043W (MCM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YMR043W (MCM1)
   03021 Transcription machinery [BR:sce03021]
    YMR043W (MCM1)
Transcription factors [BR:sce03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, Yeast regulators
    YMR043W (MCM1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     YMR043W (MCM1)
SSDB
Motif
Pfam: SRF-TF SUIM_assoc PI3K_1B_p101
Other DBs
NCBI-GeneID: 855060
NCBI-ProteinID: NP_013757
SGD: S000004646
UniProt: P11746
Structure
LinkDB
Position
XIII:353871..354731
AA seq 286 aa
MSDIEEGTPTNNGQQKERRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLL
LVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDDEEEDEEEDGDDDDDDDDDGND
MQRQQPQQQQPQQQQQVLNAHANSLGHLNQDQVPAGALKQEVKSQLLGGANPNQNSMIQQ
QQHHTQNSQPQQQQQQQPQQQMSQQQMSQHPRPQQGIPHPQQSQPQQQQQQQQQLQQQQQ
QQQQQPLTGIHQPHQQAFANAASPYLNAEQNAAYQQYFQEPQQGQY
NT seq 861 nt   +upstreamnt  +downstreamnt
atgtcagacatcgaagaaggtacgcctactaataatgggcaacagaaggagagaagaaag
atagaaattaagttcatcgagaataaaacaaggcgccatgtgacattttccaaaaggaag
cacggtatcatgaaaaaggcgtttgagctttctgttctaacggggacccaggtcctgttg
ctagtcgtttcagaaacaggtttggtatatactttcagcacgccgaagtttgaacctata
gtcacgcagcaggaaggtagaaacctgatccaggcctgtcttaacgcccctgatgatgag
gaagaagacgaggaggaagacggtgatgatgatgatgatgatgacgatgatggtaatgat
atgcaacgccagcaaccacaacaacagcaaccgcaacaacagcaacaagtattgaatgca
cacgcaaatagcttaggccatctaaatcaagatcaggtaccggcaggcgcgctgaaacaa
gaggtgaagtcacaattgctaggcggtgccaatcctaatcaaaactcaatgattcaacag
cagcaacatcacacgcagaattcacaaccacaacagcaacagcaacaacaaccacagcag
caaatgtcacagcaacaaatgtcacagcatcctcgaccacagcaaggaataccacatccg
caacaatcgcagccacagcaacagcaacaacaacaacaacaactgcaacagcagcaacag
cagcaacaacaacaacccctcaccggcattcatcagcctcaccaacaggcttttgccaac
gctgcctccccctatctgaatgctgaacagaatgctgcctaccaacaatactttcaagaa
ccgcaacaaggccaatactaa

DBGET integrated database retrieval system