KEGG   Saccharomyces cerevisiae (budding yeast): YMR080C
Entry
YMR080C           CDS       T00005                                 
Symbol
NAM7, IFS2, MOF4, SUP113, SUT2, UPF1
Name
(RefSeq) ATP-dependent RNA helicase NAM7
  KO
K14326  regulator of nonsense transcripts 1 [EC:3.6.4.13 5.6.2.3]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  Nucleocytoplasmic transport
sce03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    YMR080C (NAM7)
   03015 mRNA surveillance pathway
    YMR080C (NAM7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YMR080C (NAM7)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     YMR080C (NAM7)
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     YMR080C (NAM7)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     YMR080C (NAM7)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     YMR080C (NAM7)
SSDB
Motif
Pfam: UPF1_Zn_bind AAA_12 AAA_11 UPF1_1B_dom AAA_30 AAA_19 Viral_helicase1 DUF2075 ResIII Helicase_RecD PhoH HEM4 DEAD AAA_22 T2SSE
Other DBs
NCBI-GeneID: 855104
NCBI-ProteinID: NP_013797
SGD: S000004685
UniProt: P30771
Structure
LinkDB
Position
XIII:complement(426712..429627)
AA seq 971 aa
MVGSGSHTPYDISNSPSDVNVQPATQLNSTLVEDDDVDNQLFEEAQVTETGFRSPSASDN
SCAYCGIDSAKCVIKCNSCKKWFCNTKNGTSSSHIVNHLVLSHHNVVSLHPDSDLGDTVL
ECYNCGRKNVFLLGFVSAKSEAVVVLLCRIPCAQTKNANWDTDQWQPLIEDRQLLSWVAE
QPTEEEKLKARLITPSQISKLEAKWRSNKDATINDIDAPEEQEAIPPLLLRYQDAYEYQR
SYGPLIKLEADYDKQLKESQALEHISVSWSLALNNRHLASFTLSTFESNELKVAIGDEMI
LWYSGMQHPDWEGRGYIVRLPNSFQDTFTLELKPSKTPPPTHLTTGFTAEFIWKGTSYDR
MQDALKKFAIDKKSISGYLYYKILGHQVVDISFDVPLPKEFSIPNFAQLNSSQSNAVSHV
LQRPLSLIQGPPGTGKTVTSATIVYHLSKIHKDRILVCAPSNVAVDHLAAKLRDLGLKVV
RLTAKSREDVESSVSNLALHNLVGRGAKGELKNLLKLKDEVGELSASDTKRFVKLVRKTE
AEILNKADVVCCTCVGAGDKRLDTKFRTVLIDESTQASEPECLIPIVKGAKQVILVGDHQ
QLGPVILERKAADAGLKQSLFERLISLGHVPIRLEVQYRMNPYLSEFPSNMFYEGSLQNG
VTIEQRTVPNSKFPWPIRGIPMMFWANYGREEISANGTSFLNRIEAMNCERIITKLFRDG
VKPEQIGVITPYEGQRAYILQYMQMNGSLDKDLYIKVEVASVDAFQGREKDYIILSCVRA
NEQQAIGFLRDPRRLNVGLTRAKYGLVILGNPRSLARNTLWNHLLIHFREKGCLVEGTLD
NLQLCTVQLVRPQPRKTERPMNAQFNVESEMGDFPKFQDFDAQSMVSFSGQIGDFGNAFV
DNTELSSYINNEYWNFENFKSAFSQKQNRNEIDDRNLYQEEASHLNSNFARELQREEQKH
ELSKDFSNLGI
NT seq 2916 nt   +upstreamnt  +downstreamnt
atggtcggttccggttctcacactccttatgatatatcaaactctccatctgatgtaaat
gtccaacccgcaacacaactaaattccaccttggtggaggatgacgatgtagataatcag
ctatttgaagaggctcaagtcactgagactggattccgttcgccttcagcttcagacaat
tcatgtgcgtattgtggtatagattctgcaaagtgtgtcatcaaatgtaattcatgtaag
aaatggttttgtaacactaaaaacggtacaagcagctcccacattgttaatcacttagtt
ttatcccaccataacgtagtttctttacatccagattctgacttaggggataccgttttg
gaatgttataactgtggacgtaagaacgtgtttttattgggatttgtttccgctaaaagt
gaggccgtggttgttttactttgtagaataccttgtgcccagacgaaaaatgcgaactgg
gatactgatcaatggcaaccattaattgaagacagacaacttttatcatgggtcgcagag
caaccaactgaagaagaaaaattgaaagctcgtttaatcactcctagccaaatttccaag
ttggaggcaaaatggagatccaataaagacgctacaattaatgatattgacgccccagag
gaacaggaagcaatcccacctttactattgagatatcaagacgcctacgaataccaaaga
tcttacgggcctttaatcaaattggaggccgactatgataaacaactcaaggaatctcaa
gctttagaacatatttctgtttcatggtccttagctttaaataataggcatttagcatct
ttcactttatctactttcgaatctaacgagttgaaagttgccatcggtgatgaaatgata
ctatggtactctggcatgcaacatcctgattgggaaggtcgtggttacattgttcggtta
ccaaatagcttccaggacacattcacattagagttaaaaccaagtaaaacgccacctcca
acacatttgaccactggttttactgctgagttcatctggaaaggtacctcttatgacagg
atgcaagacgcattgaaaaaatttgccattgataaaaaatctatttcaggttatttgtac
tataaaattttaggccatcaagtggttgacatttcatttgatgtcccattacctaaggag
ttttcaattccgaattttgcacaattaaactcatcccagtcgaacgctgttagtcatgta
ttacaacgtccgttatctttaattcaaggcccaccaggcactggtaaaacagttacttca
gcaacgattgtgtatcacctttccaaaatacacaaggatagaatattggtgtgtgcccca
tcaaacgttgctgtagatcatttggctgccaaattacgtgacttgggtttaaaagttgtt
agacttaccgcgaaaagtagagaagatgtggagagttccgtctccaacttagcattgcat
aatttggttggccgtggtgctaaaggggaattaaaaaacctattaaagttaaaggatgaa
gttggcgaattatctgcttctgatacaaaacggtttgttaaattagtaaggaaaacagaa
gcagaaattctcaataaggcagatgtcgtatgttgcacatgtgttggtgctggtgataag
cgcttagacactaaatttaggactgtgttaattgatgaaagtactcaagcttctgagccg
gaatgtttaatcccaatcgttaaaggtgcgaaacaagttatacttgttggtgatcaccag
caactgggcccagtcatattggaacgaaaggcggcagacgctggtttgaaacaatctctc
tttgaaagattaatctctctaggccacgtaccgattcgtttggaagttcaataccgtatg
aatccttatttgagtgagtttccaagtaacatgttttatgaaggcagcctacaaaatggt
gtaacgattgaacagcgtaccgttcccaacagcaaattcccatggccaattcgcggtata
ccaatgatgttttgggccaattacggtagagaggagatttctgctaacggtacttccttc
ttaaacagaattgaagccatgaattgtgaacgaatcatcactaaacttttcagagacggt
gtcaagcccgagcaaattggtgttatcacaccatatgagggacaaagagcttatatttta
caatatatgcaaatgaatggttcattggataaggatttgtatatcaaagtggaagttgcc
tcagttgatgcattccaaggtcgtgaaaaggattacataatcttatcgtgtgttcgtgcc
aatgaacaacaggccattggtttcttacgtgatcctcgtcgtctaaacgtgggtctaacc
cgtgccaaatatggtctagttattcttggtaatcctagatctttggcaagaaacacatta
tggaaccatctgttaatccacttcagagagaagggttgtttagtcgaaggtacgttggat
aacttacagttatgcactgttcaattagttcgtcctcagccaagaaagactgaacggcca
atgaacgctcaatttaacgtagaatctgaaatgggtgactttccgaagttccaggatttt
gatgcacagagtatggtgtcattcagtggtcaaattggggactttggtaatgcatttgtt
gacaacacagaactttcttcttacatcaataatgaatattggaattttgagaattttaaa
agtgctttttctcaaaagcaaaatcgcaatgaaattgacgatagaaatttgtaccaggag
gaggcttctcatttgaactctaacttcgcgagagagttacagagagaagaacaaaagcat
gaattgtcaaaagacttcagcaatttgggaatataa

DBGET integrated database retrieval system