KEGG   Saccharomyces cerevisiae (budding yeast): YMR167W
Entry
YMR167W           CDS       T00005                                 
Symbol
MLH1, PMS2
Name
(RefSeq) mismatch repair ATPase MLH1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    YMR167W (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YMR167W (MLH1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     YMR167W (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 855203
NCBI-ProteinID: NP_013890
SGD: S000004777
UniProt: P38920
Structure
LinkDB
Position
XIII:594886..597195
AA seq 769 aa
MSLRIKALDASVVNKIAAGEIIISPVNALKEMMENSIDANATMIDILVKEGGIKVLQITD
NGSGINKADLPILCERFTTSKLQKFEDLSQIQTYGFRGEALASISHVARVTVTTKVKEDR
CAWRVSYAEGKMLESPKPVAGKDGTTILVEDLFFNIPSRLRALRSHNDEYSKILDVVGRY
AIHSKDIGFSCKKFGDSNYSLSVKPSYTVQDRIRTVFNKSVASNLITFHISKVEDLNLES
VDGKVCNLNFISKKSISPIFFINNRLVTCDLLRRALNSVYSNYLPKGNRPFIYLGIVIDP
AAVDVNVHPTKREVRFLSQDEIIEKIANQLHAELSAIDTSRTFKASSISTNKPESLIPFN
DTIESDRNRKSLRQAQVVENSYTTANSQLRKAKRQENKLVRIDASQAKITSFLSSSQQFN
FEGSSTKRQLSEPKVTNVSHSQEAEKLTLNESEQPRDANTINDNDLKDQPKKKQKLGDYK
VPSIADDEKNALPISKDGYIRVPKERVNVNLTSIKKLREKVDDSIHRELTDIFANLNYVG
VVDEERRLAAIQHDLKLFLIDYGSVCYELFYQIGLTDFANFGKINLQSTNVSDDIVLYNL
LSEFDELNDDASKEKIISKIWDMSSMLNEYYSIELVNDGLDNDLKSVKLKSLPLLLKGYI
PSLVKLPFFIYRLGKEVDWEDEQECLDGILREIALLYIPDMVPKVDTSDASLSEDEKAQF
INRKEHISSLLEHVLFPCIKRRFLAPRHILKDVVEIANLPDLYKVFERC
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgtctctcagaataaaagcacttgatgcatcagtggttaacaaaattgctgcaggtgag
atcataatatcccccgtaaatgctctcaaagaaatgatggagaattccatcgatgcgaat
gctacaatgattgatattctagtcaaggaaggaggaattaaggtacttcaaataacagat
aacggatctggaattaataaagcagacctgccaatcttatgtgagcgattcacgacgtcc
aaattacaaaaattcgaagatttgagtcagattcaaacgtatggattccgaggagaagct
ttagccagtatctcacatgtggcaagagtcacagtaacgacaaaagttaaagaagacaga
tgtgcatggagagtttcatatgcagaaggtaagatgttggaaagccccaaacctgttgct
ggaaaagacggtaccacgatcctagttgaagacctttttttcaatattccttctagatta
agggccttgaggtcccataatgatgaatactctaaaatattagatgttgtcgggcgatac
gccattcattccaaggacattggcttttcttgtaaaaagttcggagactctaattattct
ttatcagttaaaccttcatataccgtccaggataggattaggactgtgttcaataaatct
gtggcttcgaatttaattacttttcatatcagcaaagtagaagatttaaacctggaaagc
gttgatggaaaggtgtgtaatttgaatttcatatccaaaaagtccatttcaccaattttt
ttcattaataatagactagtgacatgtgatcttctaagaagagctttgaacagcgtttac
tccaattatctgccaaagggcaacagaccttttatttatttgggaattgttatagatccg
gcggctgttgatgttaacgttcacccgacaaagagagaggttcgtttcctgagccaagat
gagatcatagagaaaatcgccaatcaattgcacgccgaattatctgccattgatacttca
cgtactttcaaggcttcttcaatttcaacaaacaagccagagtcattgataccatttaat
gacaccatagaaagtgataggaataggaagagtctccgacaagcccaagtggtagagaat
tcatatacgacagccaatagtcaactaaggaaagcgaaaagacaagagaataaactagtc
agaatagatgcttcacaagctaaaattacgtcatttttatcctcaagtcaacagttcaac
tttgaaggatcgtctacaaagcgacaactgagtgaacccaaggtaacaaatgtaagccac
tcccaagaggcagaaaagctgacactaaatgaaagcgaacaaccgcgtgatgccaataca
atcaatgataatgacttgaaggatcaacctaagaagaaacaaaagttgggggattataaa
gttccaagcattgccgatgacgaaaagaatgcactcccgatttcaaaagacgggtatatt
agagtacctaaggagcgagttaatgttaatcttacgagtatcaagaaattgcgtgaaaaa
gtagatgattcgatacatcgagaactaacagacatttttgcaaatttgaattacgttggg
gttgtagatgaggaaagaagattagccgctattcagcatgacttaaagctttttttaata
gattacggatctgtgtgctatgagctattctatcagattggtttgacagacttcgcaaac
tttggtaagataaacctacagagtacaaatgtgtcagatgatatagttttgtataatctc
ctatcagaatttgacgagttaaatgacgatgcttccaaagaaaaaataattagtaaaata
tgggacatgagcagtatgctaaatgagtactattccatagaattggtgaatgatggtcta
gataatgacttaaagtctgtgaagctaaaatctctaccactacttttaaaaggctacatt
ccatctctggtcaagttaccattttttatatatcgcctgggtaaagaagttgattgggag
gatgaacaagagtgtctagatggtattttaagagagattgcattactctatatacctgat
atggttccgaaagtcgatacatctgatgcatcgttgtcagaagacgaaaaagcccagttt
ataaatagaaaggaacacatatcctcattactagaacacgttctcttcccttgtatcaaa
cgaaggttcctggcccctagacacattctcaaggatgtcgtggaaatagccaaccttcca
gatctatacaaagtttttgagaggtgttaa

DBGET integrated database retrieval system