KEGG   Saccharomyces cerevisiae (budding yeast): YMR224C
Entry
YMR224C           CDS       T00005                                 
Symbol
MRE11, NGS1, RAD58, XRS4
Name
(RefSeq) MRX complex nuclease subunit
  KO
K10865  double-strand break repair protein MRE11
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03440  Homologous recombination
sce03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YMR224C (MRE11)
   03450 Non-homologous end-joining
    YMR224C (MRE11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YMR224C (MRE11)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YMR224C (MRE11)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Termination Factors
   MRN complex
    YMR224C (MRE11)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     YMR224C (MRE11)
    BRCA1-C complex
     YMR224C (MRE11)
   NHEJ (non-homologous end-joining)
    MRX complex
     YMR224C (MRE11)
SSDB
Motif
Pfam: Mre11_DNA_bind Metallophos
Other DBs
NCBI-GeneID: 855264
NCBI-ProteinID: NP_013951
SGD: S000004837
UniProt: P32829
LinkDB
Position
XIII:complement(718575..720653)
AA seq 692 aa
MDYPDPDTIRILITTDNHVGYNENDPITGDDSWKTFHEVMMLAKNNNVDMVVQSGDLFHV
NKPSKKSLYQVLKTLRLCCMGDKPCELELLSDPSQVFHYDEFTNVNYEDPNFNISIPVFG
ISGNHDDASGDSLLCPMDILHATGLINHFGKVIESDKIKVVPLLFQKGSTKLALYGLAAV
RDERLFRTFKDGGVTFEVPTMREGEWFNLMCVHQNHTGHTNTAFLPEQFLPDFLDMVIWG
HEHECIPNLVHNPIKNFDVLQPGSSVATSLCEAEAQPKYVFILDIKYGEAPKMTPIPLET
IRTFKMKSISLQDVPHLRPHDKDATSKYLIEQVEEMIRDANEETKQKLADDGEGDMVAEL
PKPLIRLRVDYSAPSNTQSPIDYQVENPRRFSNRFVGRVANGNNVVQFYKKRSPVTRSKK
SGINGTSISDRDVEKLFSESGGELEVQTLVNDLLNKMQLSLLPEVGLNEAVKKFVDKDEK
TALKEFISHEISNEVGILSTNEEFLRTDDAEEMKALIKQVKRANSVRPTPPKENDETNFA
FNGNGLDSFRSSNREVRTGSPDITQSHVDNESRITHISQAESSKPTSKPKRVRTATKKKI
PAFSDSTVISDAENELGDNNDAQDDVDIDENDIIMVSTDEEDASYGLLNGRKTKTKTRPA
ASTKTASRRGKGRASRTPKTDILGSLLAKKRK
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggactatcctgatccagacacaataaggattttaattactacagataatcatgtgggt
tacaacgaaaatgatcccattactggcgatgattcttggaaaactttccatgaagtcatg
atgctggccaaaaataacaacgtagacatggttgtacagtccggtgatctttttcacgtg
aataagccttccaagaagtcactctaccaagtactgaagactttgagattatgttgcatg
ggtgacaagccttgcgagttagaattattgagcgatccctcacaagtttttcactacgat
gaatttaccaacgttaactatgaggaccccaactttaatatttctattcccgtattcggc
atatcaggtaatcatgatgatgcgtcgggggactcactgttgtgtcctatggatatactt
catgcgactggtctaataaatcatttcgggaaagtcatcgaatctgataaaataaaagtc
gtgccattattatttcagaaagggtccactaagttagcattgtacggattagccgctgtt
cgtgatgaaaggttatttagaacttttaaggatggtggtgtcacttttgaagtaccgact
atgcgagaaggtgaatggtttaatttaatgtgcgtccatcaaaatcatacaggtcacacg
aatactgcatttttacctgaacagttcttgccagatttcctggatatggtgatatggggt
catgaacatgagtgtattccgaatctcgtacacaatccaattaaaaattttgatgtatta
caaccaggttcatctgtagctacttcactttgtgaggctgaggcacaacccaagtatgtc
tttatccttgacataaagtatggagaagcaccaaaaatgacacctattcctcttgagact
atacggacattcaaaatgaaatccatttcgttacaagatgttccccatttgaggcctcac
gataaagatgctacgtctaagtatcttattgaacaagttgaagaaatgatccgcgacgct
aatgaggaaactaaacaaaaattagcggacgatggtgaaggtgacatggttgcggaatta
ccgaaaccattgatcagattacgtgttgattatagtgcaccctccaatacacaatcccca
atagattaccaagttgaaaacccgcgtagatttagcaatcgatttgtgggacgtgttgct
aacggtaataacgttgtgcagttttataaaaaaaggtcacctgtaactagatcaaaaaaa
tccggtataaatggaacaagcatcagtgatagagatgttgagaaacttttcagcgaaagt
ggcggtgaactagaagttcaaactttggttaatgatctcttgaacaaaatgcaactatct
ttattaccagaagttggtttgaatgaagcagtaaagaagtttgtagataaagatgagaaa
acagctcttaaagaatttattagccatgaaatatcgaacgaagttggaatattatctacg
aatgaagaatttctgagaacagatgatgcagaggaaatgaaagcgcttataaaacaggtt
aagcgtgctaacagtgttaggccgactccccctaaagaaaatgatgagacaaatttcgca
ttcaatggtaatgggctagattccttccggtctagtaatagagaagtaagaactggatct
ccagacattacccaatcacatgttgataatgaatcaagaataacccatattagtcaagcg
gaaagcagtaagccaacgagcaaacccaaacgagtgcgaactgcaacgaaaaagaaaatt
cctgctttttcagactcaactgtcatatccgatgcagaaaatgaactcggtgataataac
gatgctcaagatgatgttgatattgatgagaatgacataattatggtcagtactgacgaa
gaggacgctagttatggtttacttaatggtcgaaaaacaaaaacaaagactcgtcctgct
gcgagcaccaaaaccgcttccagaaggggaaaaggaagagcatcaaggacgccaaagacg
gatattcttggaagtctccttgctaagaaaagaaaatag

DBGET integrated database retrieval system