KEGG   Saccharomyces cerevisiae (budding yeast): YMR284W
Entry
YMR284W           CDS       T00005                                 
Symbol
YKU70, HDF1, NES24
Name
(RefSeq) ATP-dependent DNA helicase YKU70
  KO
K10884  ATP-dependent DNA helicase 2 subunit 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    YMR284W (YKU70)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sce03041]
    YMR284W (YKU70)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YMR284W (YKU70)
Spliceosome [BR:sce03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    YMR284W (YKU70)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     YMR284W (YKU70)
SSDB
Motif
Pfam: Ku_N Ku Ku_C DUF2170 HOOK_N
Other DBs
NCBI-GeneID: 855328
NCBI-ProteinID: NP_014011
SGD: S000004897
UniProt: P32807
Structure
LinkDB
Position
XIII:838187..839995
AA seq 602 aa
MRSVTNAFGNSGELNDQVDETGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILE
SLDELMSQLVITRPGTAIGCYFYYCNREDAKEGIYELFPLRDINATFMKKLNDLLEDLSS
GRISLYDYFMFQQTGSEKQVRLSVLFTFMLDTFLEEIPGQKQLSNKRVFLFTDIDKPQEA
QDIDERARLRRLTIDLFDNKVNFATFFIGYADKPFDNEFYSDILQLGSHTNENTGLDSEF
DGPSTKPIDAKYIKSRILRKKEVKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYK
LVYEHEDIRQEAYSKRKFLNPITGEDVTGKTVKVYPYGDLDINLSDSQDQIVMEAYTQKD
AFLKIIGFRSSSKSIHYFNNIDKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGK
LKSNSHPSLYTLSPSSVKDYNEGFYLYRVPFLDEIRKFPSLLSYDDGSEHKLDYDNMKKV
TQSIMGYFNLRDGYNPSDFKNPLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDD
SLRKLYYIRNKILESEKSEDPIIQRLNKYVKIWNMFYKKFNDDNISIKEEKKPFDKKPKF
NI
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgcgctcagtcactaatgcatttggcaatagtggagaacttaacgatcaagtggatgaa
acaggttataggaagtttgatatccatgaaggaattttgttttgcattgaactatcagag
acaatgtttaaagagtcctctgatctagagtataaatcaccattgttggaaattctggaa
tcactagatgagctaatgtcacaattggtcataacaagacctgggacagctattggttgc
tatttttattactgtaacagagaggatgccaaggaaggtatctatgaactttttccatta
agggatataaatgctacatttatgaagaaattgaacgatcttttagaagatttatcatcg
gggagaataagcctatacgactattttatgtttcaacaaactgggagtgaaaagcaagtg
cgcttatctgtattattcacattcatgcttgacacttttttggaagagattccgggtcaa
aagcaattaagcaacaagagagtgttcttattcactgacattgataaaccacaagaggcg
caagatatcgatgaacgggcaagattgagaaggcttacaattgatttatttgataacaaa
gtgaattttgcaactttttttattggctatgccgataaaccatttgacaacgagttttat
tcggacatactgcagttgggttcacatacaaatgagaatactggtttggattctgaattt
gatggtccaagtacaaagcctatagatgctaaatacatcaagtccagaatcctaaggaaa
aaggaggtaaagaggataatgtttcaatgtccattaatcttggatgagaaaacaaatttt
atagtcggagtcaagggttacactatgtatacccatgaaaaagctggagtcaggtataaa
cttgtttatgagcatgaagatatcagacaagaagcatattcaaaaagaaaatttttaaat
cctataacaggagaagacgttactggtaaaactgtcaaggtttatccttatggtgacctc
gatatcaatctatcagatagtcaagatcagatagtaatggaggcttatactcaaaaagat
gcgtttttgaagattattgggttccgttcatcgagcaaatcgatacactatttcaataac
atagacaaaagttcgtttatcgtaccagatgaagcaaaatatgaaggttcgataagaacc
ttggcttctttattaaaaattttgagaaaaaaagataaaattgcaatattatgggggaag
cttaaatcaaattcacatccttcactatatacgttatcaccctcaagcgtgaaggactac
aacgaaggattttatctctacagggttccattcctagacgaaattcgaaaatttcctagt
ttactatcctatgatgatggctctgaacataaactagattatgataacatgaaaaaagta
actcaaagtataatgggatactttaacttgagggatggatataacccatccgatttcaaa
aacccactattacaaaaacattacaaagttttacatgattacctgttgcaaattgaaacc
acttttgacgaaaatgagacacctaatactaaaaaagacagaatgatgcgtgaggacgat
tctttaaggaaactatattatatacgaaataaaattttagaatctgagaagtcagaagat
ccaatcatccaaaggctaaataaatatgttaaaatctggaatatgttctacaaaaaattt
aacgatgataacatttcgataaaagaagaaaagaagccctttgataaaaagccgaaattc
aatatataa

DBGET integrated database retrieval system