KEGG   Saccharomyces cerevisiae (budding yeast): YNL082W
Entry
YNL082W           CDS       T00005                                 
Symbol
PMS1
Name
(RefSeq) ATP-binding mismatch repair protein
  KO
K10858  DNA mismatch repair protein PMS2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    YNL082W (PMS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sce03400]
    YNL082W (PMS1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     YNL082W (PMS1)
SSDB
Motif
Pfam: DNA_mis_repair MutL_C HATPase_c_3 HATPase_c GlcNAc-1_reg
Other DBs
NCBI-GeneID: 855642
NCBI-ProteinID: NP_014317
SGD: S000005026
UniProt: P14242
Structure
LinkDB
Position
XIV:473391..476012
AA seq 873 aa
MTQIHQINDIDVHRITSGQVITDLTTAVKELVDNSIDANANQIEIIFKDYGLESIECSDN
GDGIDPSNYEFLALKHYTSKIAKFQDVAKVQTLGFRGEALSSLCGIAKLSVITTTSPPKA
DKLEYDMVGHITSKTTTSRNKGTTVLVSQLFHNLPVRQKEFSKTFKRQFTKCLTVIQGYA
IINAAIKFSVWNITPKGKKNLILSTMRNSSMRKNISSVFGAGGMRGLEEVDLVLDLNPFK
NRMLGKYTDDPDFLDLDYKIRVKGYISQNSFGCGRNSKDRQFIYVNKRPVEYSTLLKCCN
EVYKTFNNVQFPAVFLNLELPMSLIDVNVTPDKRVILLHNERAVIDIFKTTLSDYYNRQE
LALPKRMCSQSEQQAQKRLKTEVFDDRSTTHESDNENYHTARSESNQSNHAHFNSTTGVI
DKSNGTELTSVMDGNYTNVTDVIGSECEVSVDSSVVLDEGNSSTPTKKLPSIKTDSQNLS
DLNLNNFSNPEFQNITSPDKARSLEKVVEEPVYFDIDGEKFQEKAVLSQADGLVFVDNEC
HEHTNDCCHQERRGSTDTEQDDEADSIYAEIEPVEINVRTPLKNSRKSISKDNYRSLSDG
LTHRKFEDEILEYNLSTKNFKEISKNGKQMSSIISKRKSEAQENIIKNKDELEDFEQGEK
YLTLTVSKNDFKKMEVVGQFNLGFIIVTRKVDNKYDLFIVDQHASDEKYNFETLQAVTVF
KSQKLIIPQPVELSVIDELVVLDNLPVFEKNGFKLKIDEEEEFGSRVKLLSLPTSKQTLF
DLGDFNELIHLIKEDGGLRRDNIRCSKIRSMFAMRACRSSIMIGKPLNKKTMTRVVHNLS
ELDKPWNCPHGRPTMRHLMELRDWSSFSKDYEI
NT seq 2622 nt   +upstreamnt  +downstreamnt
atgacacaaattcatcagataaacgatatagatgttcatcgaattacatctggacaagtt
atcaccgacttaacaactgcagtgaaagaactcgttgataatagtatagatgcgaacgca
aaccagatcgaaataatctttaaagattatggtcttgaatctatcgaatgttctgataat
ggtgatggcatagacccttcaaattatgagttcttagctttaaaacattacacatcaaaa
attgcgaaatttcaagatgttgctaaagtacagacgttagggtttagaggggaggcccta
tcttctttatgtggcatagctaaactaagtgtgataacaacaacttcaccaccaaaagcg
gataagttggagtatgatatggtcggtcacattacttcaaagacaacgacatcaagaaat
aaagggacgaccgtgttagtttcgcagttatttcataacttgcccgttagacagaaagaa
tttagcaaaacttttaagcgccagtttaccaaatgtctcacagttatacaaggttatgca
atcataaatgctgccattaaattttcagtttggaatatcacaccaaagggtaaaaaaaat
ctaattctatcaacaatgagaaattcaagtatgagaaagaatatatcctcagtattcggt
gcaggtggtatgcgtgggcttgaagaggttgatttagtgcttgatttaaatcccttcaag
aatagaatgcttgggaaatacaccgatgatcctgatttcttagacctcgattataaaatt
cgagtgaagggctatatatcacagaattcgtttggttgtggtagaaatagtaaggatagg
caattcatttatgtgaataaaaggccagtggaatactctacgcttttaaaatgctgcaat
gaggtttacaaaacgttcaataatgttcaatttccggctgtatttctcaatcttgaatta
cccatgagcttaattgatgtaaacgtcactccagacaaaagagtgatactgttgcacaac
gaacgggccgtcattgatattttcaaaacaactctcagtgattattacaatagacaagaa
ttagctcttcccaaaagaatgtgctcacaatcagaacaacaagctcagaaaagacttaaa
acggaagtctttgatgatagaagcacaacacacgaatccgataatgaaaactatcatacc
gccagaagcgaaagtaatcaatccaatcatgcacattttaatagtactactggcgtaata
gacaaaagtaatggtacagaactaacttctgtgatggacggtaattatactaatgtcact
gatgtcatcggttcggagtgtgaagtttcggttgattcatcagttgtattggatgagggc
aactcaagtacaccgactaagaagctgccaagtatcaaaacagattctcaaaacctaagt
gatctgaacctgaataatttttccaatcctgaatttcaaaatataactagtccagataaa
gcacgtagcttggaaaaagttgttgaagaaccagtttattttgatattgatggtgaaaag
ttccaagaaaaagcggttctatcacaagcagatggtttagtttttgtagataatgaatgt
catgagcatacaaatgactgctgtcatcaagaaagaagaggaagtactgacacagaacaa
gatgatgaagctgactctatatacgcagagattgagccagttgaaatcaatgtgagaact
cctctaaagaactcacgtaaatcgatttccaaagataattataggtcattgagtgatgga
ttgacgcatcgcaaattcgaagatgagatattggagtacaatttaagcacaaaaaatttt
aaagaaataagtaaaaatggcaaacaaatgagtagcatcataagtaaaagaaaatcagaa
gctcaagaaaacattatcaaaaataaggacgaactagaggatttcgaacaaggagaaaag
tatctgacgttaacagtttcaaaaaatgattttaaaaaaatggaggttgttggacaattt
aatttaggatttatcatagtgaccagaaaagttgataacaaatatgatctgtttattgtc
gatcagcatgcaagtgatgaaaagtataatttcgaaacactgcaggccgtgacagttttt
aaatcgcagaaattgataatacctcagccggtagaattaagtgtcattgatgaacttgtg
gtgctggacaatttaccagtttttgaaaagaatggattcaaattgaaaattgacgaagaa
gaagagtttggctccagagttaagctgttaagcttacctacttccaaacaaacccttttt
gatttgggtgattttaatgaactgatacatttgatcaaagaagacggtgggttacgaaga
gacaacatcagatgttccaagattcgttctatgtttgctatgagagcatgtagaagtagt
ataatgataggtaaaccgctgaataagaagactatgaccagagtcgttcataatctcagt
gaacttgataagccttggaattgtccccatggacgtccaacaatgagacatttaatggaa
ttacgtgattggagctcattttcgaaggattacgaaatatga

DBGET integrated database retrieval system