KEGG   Saccharomyces cerevisiae (budding yeast): YNL189W
Entry
YNL189W           CDS       T00005                                 
Symbol
SRP1, KAP60, SCM1
Name
(RefSeq) karyopherin alpha
  KO
K15042  importin subunit alpha-6/7
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  Nucleocytoplasmic transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    YNL189W (SRP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sce03036]
    YNL189W (SRP1)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    YNL189W (SRP1)
SSDB
Motif
Pfam: Arm IBB Arm_3 HEAT_EZ HEAT_2 Arm_2 V-ATPase_H_C Adaptin_N Atx10homo_assoc FAST_1
Other DBs
NCBI-GeneID: 855532
NCBI-ProteinID: NP_014210
SGD: S000005133
UniProt: Q02821
Structure
LinkDB
Position
XIV:284260..285888
AA seq 542 aa
MDNGTDSSTSKFVPEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFIP
PTDGADSDEEDESSVSADQQFYSQLQQELPQMTQQLNSDDMQEQLSATVKFRQILSREHR
PPIDVVIQAGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQ
LLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLS
NLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRI
PKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKE
ACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSGGLQRPDI
IRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKA
GGMEKIFNCQQNENDKIYEKAYKIIETYFGEEEDAVDETMAPQNAGNTFGFGSNVNQQFN
FN
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggataatggtacagattcttccacgagcaagttcgttcccgaatatagacgaacaaac
tttaagaataaaggcagattctctgcagatgaacttcgtcgtcgtagagatacacaacag
gtcgaattaagaaaagcaaaaagagatgaagctttggccaaaagaagaaactttattccc
ccaactgatggcgctgattctgatgaagaagatgagagctccgtttctgcggaccaacaa
ttttacagccagttgcagcaagaactaccacaaatgactcagcaacttaactctgatgat
atgcaagagcaattgagtgctactgttaagtttagacaaattttgtctagagaacaccgc
cctccaattgatgtcgtcattcaagccggtgttgttccaagattagtagaatttatgcgt
gaaaaccaacctgaaatgttacaattggaggctgcttgggctttgactaacattgcatca
ggtacatctgctcaaacaaaagtggttgttgatgctgacgctgtacctcttttcattcaa
ctattatataccggctccgttgaagttaaagaacaagccatttgggccttaggtaacgtt
gcaggtgattcaactgactacagagactacgttttacaatgtaatgccatggagccaatt
ttgggtctttttaactccaataaaccatctttgatcaggaccgctacgtggactttatcc
aatttatgcaggggtaaaaaaccacaaccagattggtcagtggtctcacaagcgttgcca
accttagcgaaattaatctattcgatggacactgaaactttagttgatgcttgttgggct
atctcttatctatctgacggaccacaagaagctattcaagcagtgatcgatgttagaatt
cctaaaagacttgttgaattactgagccatgaatcgactttagtccagactcctgcttta
agagctgtaggtaatatagtcactggtaatgacttacagactcaggtcgttataaatgct
ggtgtcttacctgcgttaagacttctgctaagctctccaaaagaaaatatcaagaaagaa
gcgtgttggaccatttccaatattacggctggtaatactgaacaaattcaagcggtaatt
gacgcgaacttgattcctccattagttaaacttttggaagttgcagaatataaaactaaa
aaagaagcttgttgggctatttccaatgcctcttcaggtggtttacaaagaccagatatc
ataagatatttagtatctcaagggtgtataaaaccattgtgtgatttgctagaaattgct
gacaacagaataattgaagttaccttagatgctcttgaaaatattttaaagatgggtgaa
gctgacaaagaagctcgtggtttgaatatcaatgaaaatgccgattttatcgaaaaggct
ggtggtatggaaaagattttcaactgtcaacaaaatgaaaatgacaagatttatgaaaaa
gcatacaaaatcattgaaacctactttggtgaagaagaagacgccgtagacgaaactatg
gctccacaaaatgccggtaatactttcggctttggttctaatgtcaaccaacaattcaat
tttaactaa

DBGET integrated database retrieval system