KEGG   Saccharomyces cerevisiae (budding yeast): YNL250W
Entry
YNL250W           CDS       T00005                                 
Symbol
RAD50
Name
(RefSeq) MRX complex DNA-binding subunit
  KO
K10866  DNA repair protein RAD50 [EC:3.6.-.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03440  Homologous recombination
sce03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    YNL250W (RAD50)
   03450 Non-homologous end-joining
    YNL250W (RAD50)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YNL250W (RAD50)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YNL250W (RAD50)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.-
    3.6.-.-
     YNL250W (RAD50)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Termination Factors
   MRN complex
    YNL250W (RAD50)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     YNL250W (RAD50)
    BRCA1-C complex
     YNL250W (RAD50)
   NHEJ (non-homologous end-joining)
    MRX complex
     YNL250W (RAD50)
SSDB
Motif
Pfam: AAA_23 Rad50_zn_hook SMC_N SbcC_Walker_B AAA_29 AAA_13 AAA_16 AAA_22
Other DBs
NCBI-GeneID: 855471
NCBI-ProteinID: NP_014149
SGD: S000005194
UniProt: P12753
LinkDB
Position
XIV:175410..179348
AA seq 1312 aa
MSAIYKLSIQGIRSFDSNDRETIEFGKPLTLIVGMNGSGKTTIIECLKYATTGDLPPNSK
GGVFIHDPKITGEKDIRAQVKLAFTSANGLNMIVTRNIQLLMKKTTTTFKTLEGQLVAIN
NSGDRSTLSTRSLELDAQVPLYLGVPKAILEYVIFCHQEDSLWPLSEPSNLKKKFDEIFQ
AMKFTKALDNLKSIKKDMSVDIKLLKQSVEHLKLDKDRSKAMKLNIHQLQTKIDQYNEEV
SEIESQLNEITEKSDKLFKSNQDFQKILSKVENLKNTKLSISDQVKRLSNSIDILDLSKP
DLQNLLANFSKVLMDKNNQLRDLETDISSLKDRQSSLQSLSNSLIRRQGELEAGKETYEK
NRNHLSSLKEAFQHKFQGLSNIENSDMAQVNHEMSQFKAFISQDLTDTIDQFAKDIQLKE
TNLSDLIKSITVDSQNLEYNKKDRSKLIHDSEELAEKLKSFKSLSTQDSLNHELENLKTY
KEKLQSWESENIIPKLNQKIEEKNNEMIILENQIEKFQDRIMKTNQQADLYAKLGLIKKS
INTKLDELQKITEKLQNDSRIRQVFPLTQEFQRADLEMDFQKLFINMQKNIAINNKKMHE
LDRRYTNALYNLNTIEKDLQDNQKSKEKVIQLLSENLPEDCTIDEYNDVLEETELSYKTA
LENLKMHQTTLEFNRKALEIAERDSCCYLCSRKFENESFKSKLLQELKTKTDANFEKTLK
DTVQNEKEYLHSLRLLEKHIITLNSINEKIDNSQKCLEKAKEETKTSKSKLDELEVDSTK
LKDEKELAESEIRPLIEKFTYLEKELKDLENSSKTISEELSIYNTSEDGIQTVDELRDQQ
RKMNDSLRELRKTISDLQMEKDEKVRENSRMINLIKEKELTVSEIESSLTQKQNIDDSIR
SKRENINDIDSRVKELEARIISLKNKKDEAQSVLDKVKNERDIQVRNKQKTVADINRLID
RFQTIYNEVVDFEAKGFDELQTTIKELELNKAQMLELKEQLDLKSNEVNEEKRKLADSNN
EEKNLKQNLELIELKSQLQHIESEISRLDVQNAEAERDKYQEESLRLRTRFEKLSSENAG
KLGEMKQLQNQIDSLTHQLRTDYKDIEKNYHKEWVELQTRSFVTDDIDVYSKALDSAIMK
YHGLKMQDINRIIDELWKRTYSGTDIDTIKIRSDEVSSTVKGKSYNYRVVMYKQDVELDM
RGRCSAGQKVLASIIIRLALSETFGANCGVIALDEPTTNLDEENIESLAKSLHNIINMRR
HQKNFQLIVITHDEKFLGHMNAAAFTDHFFKVKRDDRQKSQIEWVDINRVTY
NT seq 3939 nt   +upstreamnt  +downstreamnt
atgagcgctatctataaattatctattcagggcatacggtcttttgactccaatgatagg
gaaactattgaatttggcaagcctctgactttaatagtcggcatgaatggttcaggtaaa
acgactatcatcgaatgtttaaagtacgctaccacaggtgatctaccgcccaacagcaag
ggaggagtattcattcatgacccgaagataactggtgaaaaggacattagagctcaggtc
aaactggcgtttacgagtgccaatggactcaatatgattgtcaccagaaatattcagttg
ctaatgaaaaagactactactacatttaagactttagaaggccagttggtcgctataaat
aatagtggtgaccgcagtactttgtccacccggtctctggaattagacgcacaagtaccc
ctgtatctgggagttccaaaagcgatcttggaatacgtgatattctgtcaccaagaagac
agcctgtggccactgagtgaaccatccaatcttaaaaagaagtttgatgaaattttccaa
gcgatgaaatttacaaaggctctagacaatttaaaatccataaagaaagacatgtccgtg
gatatcaagttattaaagcaatcagtagaacacttaaagttggataaagacagatcgaaa
gcaatgaagctcaatatccaccaattgcaaactaagatagatcagtataatgaagaagtg
tctgaaattgaatctcaattgaatgaaatcactgagaaatccgataaactgtttaaatct
aatcaagatttccaaaaaatactatccaaagtagagaacttgaaaaatacaaaactctca
attagtgatcaagtgaaaagattgtcaaactcaattgatattctcgatttatcgaagcca
gatttgcaaaacttattggcaaacttctctaaagtcttgatggataagaataatcagttg
agagatttggaaaccgatatttcaagtttgaaagaccgtcagtcatccttgcagagcctt
tctaattccctcatcaggcggcagggtgagttagaagctggtaaggagacatacgaaaag
aacagaaatcacctttcatcgctaaaagaagccttccaacataagttccaaggcctttca
aatattgaaaacagtgatatggctcaagtaaatcacgaaatgtcacagttcaaggctttc
atctctcaggatttaactgacactatagatcaatttgcaaaggatattcaactaaaggaa
acaaatttatccgacttgataaaatcaataaccgtcgattcacagaatttggaatataat
aaaaaggacagatctaaattaatccatgactctgaagagcttgctgagaaattgaaatca
tttaaaagtttgtctactcaagatagcctcaatcatgaactggaaaacttaaaaacatac
aaagaaaagctgcaatcttgggaaagtgagaatattataccaaaattgaaccagaaaata
gaagagaaaaataatgagatgattatcttagagaatcaaattgagaaatttcaagatcgc
ataatgaaaacgaatcaacaagcggacttatacgccaaactaggactaataaagaagtcc
attaatactaaattagacgagttacaaaagattacggaaaaattacagaatgattctaga
ataaggcaagtatttcccctcacccaggaatttcaaagagctgatttagaaatggatttt
cagaaattattcatcaatatgcaaaagaatatagcgatcaacaacaaaaagatgcacgaa
ttggatagaagatatacaaacgctttgtacaatttgaacaccattgaaaaggatttacag
gataatcagaagtcgaaagaaaaagtgatacaactactaagcgaaaacttaccagaggat
tgtactattgatgaatataatgatgtcctggaagaaacggagctctcctataagactgcg
ctggaaaacttgaaaatgcatcaaactactttagaatttaatagaaaagcattagagatc
gctgaacgtgacagctgctgttatttgtgttctagaaagtttgaaaatgaatcgtttaaa
agtaagttgttacaagaactaaaaacaaaaacagacgcaaattttgaaaaaactttgaaa
gacactgtccaaaacgaaaaggaatatcttcatagtttaaggctactggagaaacatatt
attacactaaattctataaatgaaaagattgataattcacagaagtgccttgaaaaagct
aaggaggaaacaaaaacttccaaatcaaaactagatgaattggaagtagattccacaaaa
ttgaaagatgagaaagagttagctgagtctgaaattcgtcctttgattgagaagtttact
tacttagaaaaggaacttaaggatcttgaaaacagttctaaaacgatatctgaggagcta
tcgatttataataccagtgaagatggtattcaaactgttgatgaattaagggaccaacaa
aggaagatgaatgattctttacgtgaactgaggaaaaccatttcagatttgcaaatggaa
aaagatgaaaaggtgagagaaaattcaagaatgattaacttgattaaagaaaaggaatta
acagtttctgaaattgaatcatctttaacacagaaacaaaatattgatgattctataagg
tcaaaaagggaaaacatcaacgatatcgattctagagtaaaggagttagaagcacgtatt
atttcattaaaaaacaaaaaggatgaagcgcaaagtgttctagacaaagtaaaaaatgaa
cgtgatattcaagtacgcaacaaacaaaaaaccgttgcagatattaatcggttaatagat
agatttcagaccatttataacgaagtggttgattttgaagctaagggcttcgatgaattg
caaacaacaataaaagaactagaattgaacaaagctcaaatgctggaactaaaggagcag
cttgatctcaagtcaaatgaagttaacgaagaaaagagaaaacttgctgactcaaataat
gaggagaaaaacttgaagcagaacttagaactaattgaattgaaatcacaacttcagcac
attgaatctgagataagtagattagacgttcaaaatgcagaagctgaaagggacaaatat
caagaggaatcactaagactaagaacaagatttgaaaagctgagctctgaaaacgcaggt
aaattaggtgaaatgaaacaattacagaatcaaatagattcattgactcatcaactgcgg
actgattacaaagatatcgagaaaaattaccataaagaatgggttgaattacagacaaga
tcctttgttactgacgacatagatgtctattcaaaagcattagatagtgctattatgaaa
tatcatggattgaaaatgcaagatataaacaggataattgatgaattatggaagcgtacg
tatagtggtactgatatagacaccatcaaaattagatcagatgaagttagtagtacagtt
aagggaaaatcatacaactatcgtgttgtaatgtacaagcaggatgttgaattggatatg
agaggacgatgttccgcgggtcaaaaagttcttgcatcgattattatcaggctagctcta
tctgaaacatttggcgcaaattgtggcgtaattgcactagacgaacctaccaccaattta
gatgaagaaaacatcgaaagtttagcaaaatctttacacaatataattaatatgagaaga
catcaaaagaatttccagctaatcgtgatcactcatgatgagaaatttttgggtcatatg
aatgcagcggcatttactgatcacttcttcaaagtcaagagagatgataggcaaaaatca
caaattgagtgggtcgatattaacagagtcacttattga

DBGET integrated database retrieval system