KEGG   Saccharomyces cerevisiae (budding yeast): YOR098C
Entry
YOR098C           CDS       T00005                                 
Symbol
NUP1
Name
(RefSeq) FG-nucleoporin NUP1
  KO
K18721  nucleoporin NUP1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  Nucleocytoplasmic transport
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    YOR098C (NUP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YOR098C (NUP1)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     YOR098C (NUP1)
SSDB
Other DBs
NCBI-GeneID: 854265
NCBI-ProteinID: NP_014741
SGD: S000005624
UniProt: P20676
Structure
LinkDB
Position
XV:complement(507948..511178)
AA seq 1076 aa
MSSNTSSVMSSPRVEKRSFSSTLKSFFTNPNKKRPSSKKVFSSNLSYANHLEESDVEDTL
HVNKRKRVSGTSQHSDSLTQNNNNAPIIIYGTENTERPPLLPILPIQRLRLLREKQRVRN
MRELGLIQSTEFPSITSSVILGSQSKSDEGGSYLCTSSTPSPIKNGSCTRQLAGKSGEDT
NVGLPILKSLKNRSNRKRFHSQSKGTVWSANFEYDLSEYDAIQKKDNKDKEGNAGGDQKT
SENRNNIKSSISNGNLATGPNLTSEIEDLRADINSNRLSNPQKNLLLKGPASTVAKTAPI
QESFVPNSERSGTPTLKKNIEPKKDKESIVLPTVGFDFIKDNETPSKKTSPKATSSAGAV
FKSSVEMGKTDKSTKTAEAPTLSFNFSQKANKTKAVDNTVPSTTLFNFGGKSDTVTSASQ
PFKFGKTSEKSENHTESDAPPKSTAPIFSFGKQEENGDEGDDENEPKRKRRLPVSEDTNT
KPLFDFGKTGDQKETKKGESEKDASGKPSFVFGASDKQAEGTPLFTFGKKADVTSNIDSS
AQFTFGKAATAKETHTKPSETPATIVKKPTFTFGQSTSENKISEGSAKPTFSFSKSEEER
KSSPISNEAAKPSFSFPGKPVDVQAPTDDKTLKPTFSFTEPAQKDSSVVSEPKKPSFTFA
SSKTSQPKPLFSFGKSDAAKEPPGSNTSFSFTKPPANETDKRPTPPSFTFGGSTTNNTTT
TSTKPSFSFGAPESMKSTASTAAANTEKLSNGFSFTKFNHNKEKSNSPTSFFDGSASSTP
IPVLGKPTDATGNTTSKSAFSFGTANTNGTNASANSTSFSFNAPATGNGTTTTSNTSGTN
IAGTFNVGKPDQSIASGNTNGAGSAFGFSSSGTAATGAASNQSSFNFGNNGAGGLNPFTS
ATSSTNANAGLFNKPPSTNAQNVNVPSAFNFTGNNSTPGGGSVFNMNGNTNANTVFAGSN
NQPHQSQTPSFNTNSSFTPSTVPNINFSGLNGGITNTATNALRPSDIFGANAASGSNSNV
TNPSSIFGGAGGVPTTSFGQPQSAPNQMGMGTNNGMSMGGGVMANRKIARMRHSKR
NT seq 3231 nt   +upstreamnt  +downstreamnt
atgtcttcaaacacttcttctgtgatgtcttctccacgtgtcgaaaagagatcgttttct
tccactttaaaatcattcttcacaaaccccaataaaaaacggccatcgagcaagaaagtt
ttcagttcaaacctctcatacgcgaatcatttggaggaatcagatgttgaagacacactg
catgttaataagagaaagagggtgtccggtacatcacagcatagcgacagcttaactcag
aacaacaataatgcgccaattataatatatggaaccgaaaacactgagagaccgccgctt
ttgccaattttgcccattcaaagactgaggttattaagggagaagcagagggtgagaaat
atgcgtgagcttggattaattcaatcaactgaatttccatctattacatcgtcggttata
ttgggctctcaaagtaaaagcgatgagggaggatcgtacctatgcacatcatctactcct
tcccctattaaaaacggttcttgcactaggcagttggccggaaaaagcggtgaagacacc
aatgttggactacccattctcaaatcattgaaaaatagatccaatagaaaaaggtttcat
agtcagtcaaaggggaccgtgtggtcagcaaattttgaatatgatttgtcagaatatgac
gctatacaaaaaaaggataacaaggataaggaaggtaacgctggcggtgatcagaagaca
agcgagaatagaaataatattaagagtagtatttcaaatggcaatctggctacaggccct
aacctgacaagcgaaattgaagacctacgtgcagacatcaactctaataggttatcgaat
cctcaaaaaaatctacttttaaaaggaccagcttccacagttgcaaaaactgcccctatt
caggagagctttgttcccaattcagagcgctctggtacgcctacgttaaagaaaaatatt
gagcccaaaaaggacaaagaaagtattgttttgcccaccgtaggttttgactttatcaag
gacaatgagactccatctaagaaaacttctcctaaggcaacttcttctgcaggtgcagtc
tttaaatcgagtgtagaaatgggaaaaaccgataagtcaacgaaaactgccgaggcgcct
accttatcattcaattttagccaaaaggctaataaaactaaggctgtcgacaatactgtc
ccttccacaactttattcaattttggtggtaaatcagataccgttacttctgccagtcaa
ccttttaaatttggaaagacatccgaaaaaagtgaaaatcatacagaatcagacgcgcct
ccaaaatcaactgctccaatattttcttttggtaaacaagaagagaatggtgatgaaggt
gatgatgaaaatgagcccaaaagaaaaaggcgtttacctgttagcgaggatacaaacacc
aagcctttattcgatttcggcaagaccggtgatcaaaaggagaccaaaaagggagagtca
gaaaaggacgcatcagggaaaccaagctttgtctttggtgcaagtgataagcaagctgaa
ggtacaccattatttacattcggaaaaaaagctgatgtaacaagcaatattgactcctct
gcacaatttacctttggtaaagccgccaccgcgaaagaaacacacaccaaaccatctgag
acacctgccacaatagtcaagaagcctacttttacttttgggcagtcaacaagtgaaaat
aagatctctgagggaagtgcgaaacctacattctctttctctaagtcagaggaggaacgt
aagagtagtccaatttcaaacgaagcagctaaaccctcgttttcgtttccgggcaagcct
gttgatgttcaagcaccgacggatgataagactctcaagccaactttttcttttactgaa
cctgctcaaaaagattcatctgttgtttcggaacctaaaaagccctcctttacgtttgcg
tcttcaaaaacctcacaaccaaagccattgttttcatttggtaagtcagatgcagctaaa
gaaccaccaggctctaacacctcattttctttcactaaacctcctgctaatgagacagat
aaaagacctacaccgccatctttcacctttggcggttccacaacaaataatacaacaacc
actagcacaaaaccatcttttagttttggggctcccgagtcgatgaagtcgacagcaagt
acagcggcagcaaatacggagaagctatcaaatggcttttcctttacaaagttcaatcac
aataaagaaaagtcaaactctccaacttctttcttcgatggttctgcttcctcaacgccg
attcctgtcttgggtaagccaacagacgctactggtaatacaacatctaaatctgcattt
tcattcggtactgctaacaccaatggtaccaatgcctcagcaaactccacatcattctcg
tttaacgcccctgctactggtaacggcacaactactacttccaatacctcaggaaccaat
atagcgggtacatttaacgtaggaaaaccggatcaaagtatcgctagtggcaatacgaat
ggagcgggctcggcatttggcttttcgagctcaggaacagcagcaactggtgcagcttct
aatcaatcttcatttaattttggaaacaatggtgcagggggtctcaatccttttacatca
gcaacttcgtcaactaatgctaatgctggtttattcaataaacctccttccacgaatgca
caaaatgtcaatgttccctctgcttttaattttacgggaaataattcaacgcctggtggc
ggctctgtatttaatatgaacggcaacactaatgctaatacggtgtttgccggctctaat
aaccaaccacatcaatcgcaaaccccatctttcaatacaaacagctcattcacgccatca
acagttcctaatattaattttagcggattgaatggcggaattactaataccgcgaccaat
gcattaaggccaagtgatatatttggtgcgaatgctgcctctggttccaattcaaacgta
acaaatccatcatccatttttgggggggcaggtggtgtgccgacaacttcttttgggcag
ccgcagtcagcccctaatcagatggggatgggaacaaataatggcatgagcatgggcggt
ggtgttatggcgaacagaaagattgcaagaatgaggcactctaaaaggtaa

DBGET integrated database retrieval system