KEGG   Saccharomyces cerevisiae (budding yeast): YOR249C
Entry
YOR249C           CDS       T00005                                 
Symbol
APC5, RMC1
Name
(RefSeq) anaphase promoting complex subunit 5
  KO
K03352  anaphase-promoting complex subunit 5
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04111  Cell cycle - yeast
sce04113  Meiosis - yeast
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YOR249C (APC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YOR249C (APC5)
   04113 Meiosis - yeast
    YOR249C (APC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YOR249C (APC5)
   03036 Chromosome and associated proteins [BR:sce03036]
    YOR249C (APC5)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     YOR249C (APC5)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    YOR249C (APC5)
SSDB
Motif
Pfam: ANAPC5
Other DBs
NCBI-GeneID: 854423
NCBI-ProteinID: NP_014892
SGD: S000005775
UniProt: Q08683
Structure
LinkDB
Position
XV:complement(798674..800731)
AA seq 685 aa
MSKYGPLGITNFITPYDLCILILIHAHCSQDNGISVPTAVFLRLISPTRPSLEWNPLLKD
NSNLRSSSIVPPPVLPILDNIIRILLDDKDGNKIALTLMGYLEAINGLDSINRLMMDLEK
NCLVNNYRSMKMRTTSTRRQMTRASFLGTFLSTCIRKYQIGDFEMRETIWINLQNFKTVF
KHTPLWLRFKDNVHIQKVKNCLLANDEISVEDQQMVEFFQHFNNGNDADSKTMNEENYGT
LISIQHLQSIVNRQIVNWLDNTEFNLMGQEETSSTYEEQSGLVFDLLDTLSLNDATKFPL
IFILKYLEAIKENSYQTALDSLHNYFDYKSTGNSQNYFHISLLSLATFHSSFNECDAAIN
SFEEATRIARENKDMETLNLIMIWIINFIEVHPEYANRFYITVEQIIKYLKNSSDVEDAN
IFSNAYKFETLLSMVKESKTAEVSSSLLKFMAITLQNVPSQNFDLFQSLVSYEVKFWKEL
GYESISDVYEKFLSKTSSSSLRNYDSSIINQDIKVAFKALEEDDFLKVKQYLLKSESLEL
DYDQKINLKYLRVKYLVKIGDYDLSMRLINQYVKECCEEVADSNWRFKFEIESINVLLLS
DVGIRSLPKIIKLIDEYKEIGNPLRCVILLLKLCEVLIQVGKSMEAECLISCNLSTILEF
PFVRKKTDELLESLSVEEDRDVQMT
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgagtaagtatggtccattgggtattactaactttattactccgtacgatctatgcata
ttaatcctaatacatgctcactgctcacaagataatggcatatcagtgccaacagcagta
tttcttcggttaatatcccctactagaccttcactagaatggaatcctctgctcaaggat
aatagtaatttaagatcttcatctattgttcctcctcctgtacttcctattctagataat
ataataaggatactgttagatgacaaggatggtaacaaaatagctctgacattaatgggc
tatttggaagcaattaatggactggattcaatcaacagactaatgatggatttagaaaag
aactgtttggttaataattacaggtcaatgaaaatgcgtacaacatcaacaagaagacaa
atgacaagagcgagttttttaggaacatttttgtcaacttgtatacgcaagtatcaaatt
ggtgattttgaaatgagggagacaatctggattaatctacaaaatttcaaaactgtattt
aagcatactccgctatggctacgatttaaagataacgttcatattcaaaaggtaaaaaac
tgtcttctggctaacgacgagatctcggtggaggatcaacagatggtggaatttttccaa
cacttcaataatggtaatgacgctgattcaaaaacaatgaacgaagaaaattatgggaca
ttgatttccatccaacatttacaatcaatagttaatcgacaaattgtgaattggttagat
aatacagaatttaatctgatgggtcaagaagaaactagttccacatatgaagaacaaagc
ggactagtttttgatttgctagatacgctttcattgaacgatgccacaaaattccctttg
atttttatattaaagtatctcgaagctataaaagagaacagttatcaaaccgcactagat
tctctacataactattttgattacaagtccacgggcaattctcaaaattacttccatatc
tccttgttgtcccttgccaccttccactcaagtttcaatgagtgtgatgcagcgataaat
tcttttgaggaagccacgagaatcgcaagggaaaataaagatatggaaacgttgaatttg
ataatgatatggataataaacttcatagaggtgcacccggaatatgcaaacagattttat
atcacagtagaacaaataataaaatatctgaaaaatagttcagatgtagaagatgccaat
attttcagtaacgcctacaagtttgaaacattgttatctatggtcaaagaatcgaaaact
gctgaagtttctagttcacttctgaaattcatggctatcactttgcagaacgtgccttct
caaaactttgatcttttccaaagtcttgttagctatgaagtaaaattttggaaagaactg
ggatacgaatccatatccgatgtatatgagaaattcctgtctaaaacatcctcttcctct
ttaaggaactacgactcttctattatcaaccaagatataaaggtagctttcaaggcactt
gaagaagacgattttttaaaagtaaaacaataccttttgaaatcagaatcactggaacta
gactacgaccaaaaaataaatttgaaatatttaagagtgaagtatctcgttaaaataggt
gactatgacctaagcatgcgattaatcaaccaatatgtcaaggagtgctgtgaagaagtg
gcggattcgaactggagattcaaatttgaaattgaaagtatcaatgttttacttttaagt
gacgtagggataagaagtttgccgaagataataaaattaatcgacgaatacaaagagata
ggaaatcctttgcgatgtgtaatattattgcttaaattatgtgaagttttgattcaggta
gggaagagtatggaggcagagtgcttgatcagctgtaacctatcaaccattctagaattc
ccatttgtaaggaagaagacagatgagcttttggaatctcttagtgttgaagaggatagg
gatgttcagatgacttga

DBGET integrated database retrieval system