KEGG   Saccharomyces cerevisiae (budding yeast): YPL022W
Entry
YPL022W           CDS       T00005                                 
Symbol
RAD1, LPB9, RAD12
Name
(RefSeq) ssDNA endodeoxyribonuclease RAD1
  KO
K10848  DNA excision repair protein ERCC-4 [EC:3.1.-.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    YPL022W (RAD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YPL022W (RAD1)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YPL022W (RAD1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-
    3.1.-.-
     YPL022W (RAD1)
DNA replication proteins [BR:sce03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    YPL022W (RAD1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     YPL022W (RAD1)
SSDB
Motif
Pfam: ERCC4
Other DBs
NCBI-GeneID: 856085
NCBI-ProteinID: NP_015303
SGD: S000005943
UniProt: P06777
LinkDB
Position
XVI:506697..509999
AA seq 1100 aa
MSQLFYQGDSDDELQEELTRQTTQASQSSKIKNEDEPDDSNHLNEVENEDSKVLDDDAVL
YPLIPNEPDDIETSKPNINDIRPVDIQLTLPLPFQQKVVENSLITEDALIIMGKGLGLLD
IVANLLHVLATPTSINGQLKRALVLVLNAKPIDNVRIKEALEELSWFSNTGKDDDDTAVE
SDDELFERPFNVVTADSLSIEKRRKLYISGGILSITSRILIVDLLSGIVHPNRVTGMLVL
NADSLRHNSNESFILEIYRSKNTWGFIKAFSEAPETFVMEFSPLRTKMKELRLKNVLLWP
RFRVEVSSCLNATNKTSHNKVIEVKVSLTNSMSQIQFGLMECLKKCIAELSRKNPELALD
WWNMENVLDINFIRSIDSVMVPNWHRISYESKQLVKDIRFLRHLLKMLVTSDAVDFFGEI
QLSLDANKPSVSRKYSESPWLLVDEAQLVISYAKKRIFYKNEYTLEENPKWEQLIHILHD
ISHERMTNHLQGPTLVACSDNLTCLELAKVLNASNKKRGVRQVLLNKLKWYRKQREETKK
LVKEVQSQDTFPENATLNVSSTFSKEQVTTKRRRTRGASQVAAVEKLRNAGTNVDMEVVF
EDHKLSEEIKKGSGDDLDDGQEENAANDSKIFEIQEQENEILIDDGDAEFDNGELEYVGD
LPQHITTHFNKDLWAEHCNEYEYVDRQDEILISTFKSLNDNCSLQEMMPSYIIMFEPDIS
FIRQIEVYKAIVKDLQPKVYFMYYGESIEEQSHLTAIKREKDAFTKLIRENANLSHHFET
NEDLSHYKNLAERKLKLSKLRKSNTRNAGGQQGFHNLTQDVVIVDTREFNASLPGLLYRY
GIRVIPCMLTVGDYVITPDICLERKSISDLIGSLQNNRLANQCKKMLKYYAYPTLLIEFD
EGQSFSLEPFSERRNYKNKDISTVHPISSKLSQDEIQLKLAKLVLRFPTLKIIWSSSPLQ
TVNIILELKLGREQPDPSNAVILGTNKVRSDFNSTAKGLKDGDNESKFKRLLNVPGVSKI
DYFNLRKKIKSFNKLQKLSWNEINELINDEDLTDRIYYFLRTEKEEQEQESTDENLESPG
KTTDDNALHDHHNDVPEAPV
NT seq 3303 nt   +upstreamnt  +downstreamnt
atgtctcagttattttatcagggcgactctgatgatgagctccaggaggaacttacgagg
cagacaactcaagcatctcaaagttctaaaattaaaaatgaagatgaacccgacgactcc
aatcatcttaatgaggtggaaaatgaagatagcaaagttttagatgacgatgcagtgtta
taccctcttatacctaatgagccagatgacatagaaacgtctaagcccaatattaacgat
attaggccagttgatattcaattgactttaccattgccgtttcagcaaaaagtggtagag
aattcattaattactgaagatgcattaatcataatggggaaaggactaggattgcttgat
attgtggccaatttattgcatgttttagctacaccaacatccattaacggacaactaaag
cgagcgctcgtcctagtgttgaatgcaaaacctatagataatgtaagaatcaaggaggcc
ttagaagagctgtcgtggttctctaatactgggaaggacgacgacgatactgctgtcgag
agcgatgatgaactttttgaaaggccttttaacgtagttaccgcggactcgctgagcatt
gaaaagagaagaaagctatatatttctggcggaatcttgagcattacttctagaattctc
attgtggatctcttatccggcattgttcacccaaatagggttacgggtatgctggtattg
aatgcagactcacttcgacataattcgaatgaatcgtttatattagagatttacaggtct
aaaaatacttggggttttattaaagccttttctgaagcaccagagacgtttgtcatggaa
ttttcacccctcaggacgaaaatgaaagaattacggctaaagaacgttttgctatggccg
aggttcagggtagaggtctcttcctgtttgaatgccactaataagacgtcacacaataaa
gtcattgaagtcaaggtctccttaacaaattccatgtctcagatacagtttggcttgatg
gaatgtttgaaaaaatgtattgctgagttaagcagaaaaaatcctgaactagctctggac
tggtggaatatggaaaatgtcctggatataaactttatcaggtcaattgactcggtgatg
gtgccgaactggcaccgaatttcttatgaatcaaaacaactggttaaggatataagattc
ctacgccaccttttaaagatgctcgtaacttcagacgcagttgacttttttggagagatt
caattaagtttggatgccaataaaccgtcagtatcccgaaaatacagcgaatcaccgtgg
ctattggtcgatgaggcacaattagtcatatcgtatgcgaagaaaagaatattttacaaa
aatgaatatactttagaagaaaatccaaaatgggaacaacttattcatatattacatgat
atttcacatgagagaatgaccaatcaccttcaggggcctactttagttgcctgttccgac
aaccttacatgtttagaactagcaaaggtcttgaatgcctcaaacaaaaaaagaggagta
cgtcaagtgcttctgaataaattgaaatggtacagaaaacagagggaggaaacgaaaaaa
ttggtcaaagaagtgcaaagtcaggacacttttccagagaatgcaacattaaatgtaagc
tcgacattttccaaagaacaagtgaccacgaaaagaagaaggacaagaggtgcttcacaa
gttgcggccgttgaaaagctaaggaatgcaggtaccaatgtagatatggaggtggttttt
gaggatcataagttatctgaagaaattaagaagggaagcggtgatgatttggatgacggt
caggaagaaaatgccgcaaacgattcaaagatttttgaaatacaagaacaggaaaatgaa
atccttatcgatgatggggatgctgaatttgacaacggagaattagagtatgtgggcgac
cttccgcagcacatcacaacccatttcaataaggatttatgggcagaacattgcaacgag
tatgaatatgttgatcgtcaggacgaaattttaatctctacgtttaaaagtctcaatgac
aattgctcattgcaggagatgatgccctcttacattataatgtttgaaccagatatatcg
tttatcaggcagattgaagtttataaggccatagtgaaggatttgcaaccaaaagtatac
ttcatgtactacggtgaaagtattgaagagcaaagtcatttgactgctatcaagagagag
aaagatgctttcacaaagttgattagagagaatgcaaatctgtcccatcactttgaaacg
aatgaagatctttctcactacaaaaatttagctgaaaggaagttgaagctttcaaaatta
cgaaaatctaataccagaaatgcgggtgggcagcagggattccataatcttactcaggat
gtcgtcattgtggatacacgtgagtttaatgcctcattaccaggcttactctaccgatat
ggcataagggttattccttgtatgttgacagtcggcgattatgtgataactcctgatatt
tgtctcgaaagaaaatcgatttctgacttaattgggtcattacagaataacagattagcc
aaccaatgtaaaaaaatgttaaaatactatgcatatccgacactattgattgagtttgat
gaaggacagtcgttttctttagaaccttttagtgaacgtagaaattataagaataaagac
atatcaactgttcatcctatatcaagcaagttatcccaggatgaaattcagctaaaacta
gccaaattagtattgcggtttcccactttaaagattatatggtcttcctcacccctgcaa
actgtaaatataatcctagagttgaaattaggacgtgagcaacctgaccctagtaatgca
gttatattgggaacgaataaagttagatcggattttaatagcactgcaaagggcctgaag
gatggtgataacgagtctaaattcaagagactgttgaatgttcctggagtgtcaaaaatt
gattatttcaatctccgcaaaaagatcaagagcttcaataagcttcaaaagctttcatgg
aatgagattaatgaacttattaatgacgaagatttgacggatagaatatactacttcttg
agaacagaaaaagaagaacaagaacaagagtcaacagatgaaaatcttgaatctcctggt
aagaccactgatgataacgctttacatgatcatcataatgatgttcctgaagcacctgtg
taa

DBGET integrated database retrieval system