KEGG   Saccharomyces cerevisiae (budding yeast): YPL046C
Entry
YPL046C           CDS       T00005                                 
Symbol
ELC1
Name
(RefSeq) elongin C
  KO
K03872  elongin-C
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    YPL046C (ELC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YPL046C (ELC1)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YPL046C (ELC1)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul2 complex
    Adoptor protein
     YPL046C (ELC1)
   Cul5 complex
     YPL046C (ELC1)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     YPL046C (ELC1)
SSDB
Motif
Pfam: Skp1_POZ
Other DBs
NCBI-GeneID: 856061
NCBI-ProteinID: NP_015279
SGD: S000005967
UniProt: Q03071
Structure
LinkDB
Position
XVI:complement(466644..466943)
AA seq 99 aa
MSQDFVTLVSKDDKEYEISRSAAMISPTLKAMIEGPFRESKGRIELKQFDSHILEKAVEY
LNYNLKYSGVSEDDDEIPEFEIPTEMSLELLLAADYLSI
NT seq 300 nt   +upstreamnt  +downstreamnt
atgtctcaagatttcgttacgttagtatcaaaagatgataaggaatatgagatatcacga
tctgctgcgatgatttcaccgacgttaaaagctatgattgagggacccttcagggaaagc
aaaggccgaatagagctcaagcagtttgactcgcatattctagaaaaggctgtggaatat
ttaaattataatttgaagtacagcggcgttagcgaggacgatgatgagattccagagttt
gaaataccgacagaaatgtcgttagagctgctacttgcggcggactatttgagtatatag

DBGET integrated database retrieval system