Squalius cephalus (European chub): 307150801 Help Entry 307150801         CDS       T11930                                  Symbol brk1 Name (RefSeq) putative protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism scep  Squalius cephalus (European chub) Pathway scep04519   Cadherin signaling scep04810   Regulation of actin cytoskeleton scep05132   Salmonella infection Brite KEGG Orthology (KO) [BR:scep00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04519 Cadherin signaling     307150801 (brk1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     307150801 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     307150801 (brk1) SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  307150801 NCBI-ProteinID:  XP_079714457 LinkDB All DBs Position 22:complement(27748429..27751177) Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggccggacaggaggatccagtgcaaagggaaattcaccaagactgggcgaaccgtgaa tatatcgaagtgatcaccagcagcattaagaaaatagccgatttcctcaattccttcgat atgtcctgcaggtcccgtttagccactttgaatgagaagcttactgctttggagaggagg attgagtacattgaagccagagtcacaaaaggggaaaccttgacttag

DBGET integrated database retrieval system