Squalius cephalus (European chub): 307159487 Help Entry 307159487         CDS       T11930                                  Symbol myl2a Name (RefSeq) myosin regulatory light chain 2a   KO K10351   myosin regulatory light chain 2 Organism scep  Squalius cephalus (European chub) Pathway scep04260   Cardiac muscle contraction scep04261   Adrenergic signaling in cardiomyocytes scep04371   Apelin signaling pathway scep04510   Focal adhesion scep04520   Adherens junction scep04530   Tight junction scep04810   Regulation of actin cytoskeleton scep04814   Motor proteins scep04820   Cytoskeleton in muscle cells scep05132   Salmonella infection Brite KEGG Orthology (KO) [BR:scep00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     307159487 (myl2a)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     307159487 (myl2a)    04520 Adherens junction     307159487 (myl2a)    04530 Tight junction     307159487 (myl2a)   09142 Cell motility    04814 Motor proteins     307159487 (myl2a)    04820 Cytoskeleton in muscle cells     307159487 (myl2a)    04810 Regulation of actin cytoskeleton     307159487 (myl2a)  09150 Organismal Systems   09153 Circulatory system    04260 Cardiac muscle contraction     307159487 (myl2a)    04261 Adrenergic signaling in cardiomyocytes     307159487 (myl2a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     307159487 (myl2a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:scep04812]     307159487 (myl2a) Cytoskeleton proteins [BR:scep04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      307159487 (myl2a) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 CFAP251_C EF-hand_5 EFhand_Ca_insen EF-hand_FSTL1 SAPC2_N TP_0677 AIF-1 EF_EFCAB10_C Motif Other DBs NCBI-GeneID:  307159487 NCBI-ProteinID:  XP_079729018 LinkDB All DBs Position 5:50186384..50192203 Genome browser AA seq 169 aa AA seqDB search MAPKKAKKRSADGANSNVFSMFEQAQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRV NVKQEEIDEMLKEASGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGILKKEYV TEMLTTQADRFSTEEMEQMFNAFPPDAAGNLDYKNLVHIITHGEEKDQE NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atggctcccaagaaagcgaagaagaggtcggcggacggagcgaactccaacgtcttctcc atgtttgaacaggctcagatccaggagttcaaggaggcgttcaccatcatggaccagaac agagacgggttcatagacaagaacgacctgagagacacgttcgcagctctgggacgggtg aacgtgaagcaggaggagatcgacgagatgctgaaggaggcttcgggcccgatcaacttc accgtcttcctcaccatgttcggagagaaactcaaaggagccgatcccgaggaaaccatc ctgaacgccttcaaagtgtttgatcctgaaggcaagggcatcctgaagaaggaatatgtc acggagatgttgaccacacaagcggacagattctccacagaggagatggagcagatgttc aacgctttccctccggatgctgcgggaaacctggactacaagaatctggtgcacatcatc actcacggagaggagaaggaccaggaataa

DBGET integrated database retrieval system