Streptomyces chartreusis: CP983_03640 Help Entry CP983_03640       CDS       T07157                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism scha  Streptomyces chartreusis Pathway scha00253   Tetracycline biosynthesis scha01056   Biosynthesis of type II polyketide backbone scha01100   Metabolic pathways scha01110   Biosynthesis of secondary metabolites Module scha_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:scha00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     CP983_03640    00253 Tetracycline biosynthesis     CP983_03640  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:scha01004]     CP983_03640    01008 Polyketide biosynthesis proteins [BR:scha01008]     CP983_03640 Lipid biosynthesis proteins [BR:scha01004]  Polyketide synthase   Component type    CP983_03640 Polyketide biosynthesis proteins [BR:scha01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      CP983_03640     Nonaketide PKS      CP983_03640     Decaketide PKS      CP983_03640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEV65874 LinkDB All DBs Position complement(861403..861660) Genome browser AA seq 85 aa AA seqDB search MSELTLEQLRTIMTECAGAADGVAPDEDIRDIEFGLLGYDSIALLETAARLERDYGISFG DEAVGQVRTPRALLDLVNNALADAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagtgaactgaccctggaacaactccggacgatcatgacggagtgcgcgggtgcggcg gacggcgtcgcaccggacgaggacatccgcgacatcgagttcgggcttctcggatacgac tcgatcgcgctgctggagaccgcggcccggctggagcgggactacggcatcagcttcggg gacgaggcggtcgggcaggtccggaccccccgggccctgctggacctggtcaacaacgcc ctcgccgacgccgcctga

DBGET integrated database retrieval system