Streptomyces chartreusis: CP983_20595 Help Entry CP983_20595       CDS       T07157                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism scha  Streptomyces chartreusis Pathway scha00998   Biosynthesis of various antibiotics scha01100   Metabolic pathways scha01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:scha00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CP983_20595   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CP983_20595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEV68828 UniProt:  A0A8E3TMC7 LinkDB All DBs Position complement(4763167..4763415) Genome browser AA seq 82 aa AA seqDB search MDPRMSETGSIEESVREIIADVLGADPADIPADQALAALGWDSMNSMEALVRLEKQFSVD LDLRSFHAAYTVTDMVALVEKF NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggatccccgcatgagtgaaacgggctcgatcgaggagtcggtgagggagatcatcgcc gacgtactgggcgccgaccccgcggacatccccgctgaccaggcactggccgcgctcggc tgggacagcatgaattcgatggaagccctggtgcgcctggagaagcagttctccgtcgat ctggacctgcggtcctttcacgccgcctacaccgtgaccgacatggtcgcgctggtcgag aaattctaa

DBGET integrated database retrieval system